DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8159 and CG1792

DIOPT Version :9

Sequence 1:NP_649823.2 Gene:CG8159 / 41040 FlyBaseID:FBgn0037619 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster


Alignment Length:371 Identity:128/371 - (34%)
Similarity:183/371 - (49%) Gaps:49/371 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRVCASSTDNSKSLKLFNSGACKVLQQINLLTGVLLQCEPG--LPDWMCETCQTDLKSAISFRDR 68
            ||.|......|....||......:|.||.:|||:.|...||  ||.::|..|:.||::||:||:|
  Fly     6 CRTCGLFIFCSTPSNLFEEPNSVMLHQIEVLTGLFLLGGPGNELPPFICSPCELDLQTAIAFRER 70

  Fly    69 CLRSQKIFEES-LVRNEE--DTFRSSVRRSARSQRQRHE----DTAP-----KTPASPLEV---- 117
            .:|:||..:|| .:.|.|  ::|...|.:..:...:..|    |..|     :....|.|:    
  Fly    71 VIRTQKTLQESPNLGNAELIESFAVGVEKEIQYAEEVTEIEVIDLLPEEHLLEETEEPYEICEQN 135

  Fly   118 ---MIKL----ESLSNGDEEDDGIDHLDSCNEADMELAIKAM-SSSTEDDGTTSPVRLKRTRRRG 174
               .:|:    :.|....:....:  ..|...||...|.:.. |..|||:    .|.|||.||: 
  Fly   136 EQPQVKVPAQEKKLRRSTKTTPTV--FTSVKFADNSQATRTQWSRLTEDE----VVALKRERRK- 193

  Fly   175 LKKGGKGENRTKVTLPVFFCDQCGNNITGKSSFDRHLRKHSGIRPFQCELCPARFLSSGELKGHQ 239
                     |..:      |:|||.:.|..|:|..||.:|:|::.|.|:.|..:|.::..|:.||
  Fly   194 ---------RDCI------CEQCGRHFTCPSNFKLHLLRHTGVKSFACDQCSQQFYTATLLRRHQ 243

  Fly   240 VMHTGDRKFQCRYCDRTYVNYSGRLRHER-THTNDRPFICAQCGKSFTNSYILKNHMLIHTGERL 303
            .:|.|:..||||||:.||.|.|||::||| .|||.:||.|.:|.|||..|..|:.|||.|||.|.
  Fly   244 ELHAGNALFQCRYCEATYSNASGRIQHERMRHTNVKPFTCKECNKSFAMSGKLRTHMLSHTGVRA 308

  Fly   304 FRCELCHRSFARPTHLKTHFRSNTHKHNLEKSMADAGGVQLSPSQS 349
            |.|:.|..||.|.:||.:|:||..|.|......|....|:|....|
  Fly   309 FHCDSCQVSFVRRSHLTSHYRSKGHAHTSSAQAALDNPVELDVKAS 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8159NP_649823.2 zf-AD 5..78 CDD:214871 29/73 (40%)
C2H2 Zn finger 194..214 CDD:275368 9/19 (47%)
COG5048 <197..322 CDD:227381 60/125 (48%)
zf-H2C2_2 206..231 CDD:290200 9/24 (38%)
C2H2 Zn finger 222..242 CDD:275368 6/19 (32%)
C2H2 Zn finger 250..270 CDD:275368 13/20 (65%)
zf-H2C2_2 265..287 CDD:290200 13/22 (59%)
C2H2 Zn finger 278..298 CDD:275368 10/19 (53%)
zf-H2C2_2 291..315 CDD:290200 13/23 (57%)
C2H2 Zn finger 306..328 CDD:275368 10/21 (48%)
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 29/73 (40%)
C2H2 Zn finger 198..218 CDD:275368 9/19 (47%)
C2H2 Zn finger 226..243 CDD:275368 4/16 (25%)
C2H2 Zn finger 254..275 CDD:275368 13/20 (65%)
zf-C2H2 281..303 CDD:278523 11/21 (52%)
C2H2 Zn finger 283..303 CDD:275368 10/19 (53%)
zf-H2C2_2 296..320 CDD:290200 13/23 (57%)
C2H2 Zn finger 311..329 CDD:275368 8/17 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447760
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 1 1.100 - - P PTHR24388
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.