DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8159 and CG4936

DIOPT Version :9

Sequence 1:NP_649823.2 Gene:CG8159 / 41040 FlyBaseID:FBgn0037619 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster


Alignment Length:482 Identity:113/482 - (23%)
Similarity:173/482 - (35%) Gaps:177/482 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VCRVCASSTDNSKSLKLFNSGACKVL-QQINLLTGVLLQCEPGLPDWMCETCQTDLKSAISFRDR 68
            |||||........: .:||..:.|.| ..|....||.::.....||.:||.|...||.|..||:.
  Fly    22 VCRVCLQQPKEPMA-SIFNDDSEKDLTHMIRECGGVPIKQFDHYPDKICEKCFKVLKMAFKFRET 85

  Fly    69 CLRS------------------QKIFEESLVRNEEDTFRSSVRRSARSQRQRHE----------- 104
            |.||                  :|...|:..:.|.|     |......|...|:           
  Fly    86 CQRSYGHLRQFVGPVEVEQRPPEKKGSETATKLEPD-----VDPDEAEQEPEHDEEDEDVDLDES 145

  Fly   105 -----DTAPKTPASPLE------VMIKLES-----LSNGDEEDDGI------------------- 134
                 |.|.:|......      ::::||.     :.|...|:|||                   
  Fly   146 HYAEADDAAETQGGVFHDEIEDGILVELEKDRIVHVKNEQVEEDGIIEEVYDVYETYEGDLIPDQ 210

  Fly   135 --DH-------------------------LDSCNEADME-------------------------- 146
              ||                         .:|.:|.|.|                          
  Fly   211 GYDHEMADQALSELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEEEFVPSKSVRASIHARNAT 275

  Fly   147 ---------------LAIKAMSSSTEDDGTTSPVRLKR-------------------------TR 171
                           :|:::.:|.|.|.|  :|::::|                         .:
  Fly   276 KRRVNPRRSATSTASVAVESSTSKTTDRG--NPLKVRRGNSDSAGSKMSIKSEKDISIGEVLARK 338

  Fly   172 RRGLK-KGGKGENRTKVTLP-----VFFCDQCGNNITGKSSFDRHLRKHSGIRPFQCELCPARFL 230
            ..|:| |||.     |:.|.     .:.||.|||....:|....|::.|||::|.:||:|...|.
  Fly   339 HSGIKTKGGH-----KILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGHCFA 398

  Fly   231 SSGELKGHQVMHTGDRKFQCRYCDRTYVNYSGRLRHERTHTNDRPFICAQCGKSFTNSYILKNHM 295
            .:.:|..|...|||:|.::|.||...:.:.|.|.:|.|.|||:||:.|..|.|:||.:..||.|.
  Fly   399 QAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFHK 463

  Fly   296 LIHTGERLFRCELCHRSFARPTHLKTH 322
            :|||||:...|::|.:.|.:...|:.|
  Fly   464 MIHTGEKPHVCDVCGKGFPQAYKLRNH 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8159NP_649823.2 zf-AD 5..78 CDD:214871 26/91 (29%)
C2H2 Zn finger 194..214 CDD:275368 7/19 (37%)
COG5048 <197..322 CDD:227381 48/124 (39%)
zf-H2C2_2 206..231 CDD:290200 9/24 (38%)
C2H2 Zn finger 222..242 CDD:275368 6/19 (32%)
C2H2 Zn finger 250..270 CDD:275368 7/19 (37%)
zf-H2C2_2 265..287 CDD:290200 11/21 (52%)
C2H2 Zn finger 278..298 CDD:275368 8/19 (42%)
zf-H2C2_2 291..315 CDD:290200 11/23 (48%)
C2H2 Zn finger 306..328 CDD:275368 5/17 (29%)
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 25/73 (34%)
C2H2 Zn finger 362..382 CDD:275368 7/19 (37%)
zf-H2C2_2 375..399 CDD:290200 9/23 (39%)
COG5048 386..>447 CDD:227381 23/60 (38%)
C2H2 Zn finger 390..410 CDD:275368 6/19 (32%)
zf-H2C2_2 403..426 CDD:290200 9/22 (41%)
C2H2 Zn finger 418..438 CDD:275368 7/19 (37%)
zf-H2C2_2 432..455 CDD:290200 11/22 (50%)
C2H2 Zn finger 446..466 CDD:275368 8/19 (42%)
zf-H2C2_2 459..481 CDD:290200 10/21 (48%)
C2H2 Zn finger 474..494 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.