DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8159 and Odj

DIOPT Version :9

Sequence 1:NP_649823.2 Gene:CG8159 / 41040 FlyBaseID:FBgn0037619 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_650661.1 Gene:Odj / 42145 FlyBaseID:FBgn0038551 Length:430 Species:Drosophila melanogaster


Alignment Length:412 Identity:101/412 - (24%)
Similarity:169/412 - (41%) Gaps:50/412 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRVCASSTDNSKSLKLFNSGACKVLQQINLLTGVLLQCEPGLPDWMCETCQTDLKSAISFRDRCL 70
            ||:|...........:|.....::...|..:||:.:..|..||..:|..|..||..|::||.|||
  Fly     5 CRICGERIFTPHPKNIFEKRNHRIRMAIEQITGLEIVLENMLPQHICACCLLDLTQAVAFRQRCL 69

  Fly    71 RS-----QKIFEESLVRNEEDTFRSSVRRSARSQRQRHEDTAPKTPASPLEVMIKLESLSNGDEE 130
            .:     |:|..::.|.::.....|.|......:|:..:||......         :.|.:.|::
  Fly    70 ETHANLHQRISSKAGVASKGSPEVSPVLSDPLLKREVLDDTVDTEDD---------KELLDDDKD 125

  Fly   131 --DDGIDHLDSCNEADMELAIKAMSSSTEDD---GTTSP-VRLKRTR--------------RRGL 175
              ||..|.|:  :|..:.....|.....||.   ...|| ||:||.|              |..:
  Fly   126 LMDDDKDFLE--DEKPILRYPPAKKIRIEDQNFPNRQSPRVRVKRLRVPVVEKADSPPPPPREHV 188

  Fly   176 KKGGKGENRTKV--TLPVFFCDQCGNNITGKSSFDRHLRKHSGIRPFQCELCPARFLSSGELKGH 238
            :|..|...:.||  ::..:.|||||.:....|:...|..:|.. ..|.|:.|..:|.:...|:.|
  Fly   189 RKPRKRRPKPKVDRSIKRYVCDQCGWSFNDHSNMKDHKLRHFE-EKFSCDECGRKFYTMPLLRLH 252

  Fly   239 -QVMHTGDRKFQCRYCDRTYVNYSGRLRHER-THTNDRPFICAQCGKSFTNSYILKNHMLIHTGE 301
             :|.|.|::.:.|::|...:.|...|.|||| .|.|:....|..|||.|.:......|...|..:
  Fly   253 IRVHHKGEKPYVCKFCGMGFANSPSRCRHERQMHANELVHPCKICGKRFNSEKGRLKHEEGHKSD 317

  Fly   302 R--LFRCELCHRSFARPTHLKTHFRSNTHKHNLEKSMADAGGVQLSPSQSADQVKF---VTEKEP 361
            :  :..|..|::.|.....|..|:.:..|:..:...:   .|.:.......|..:|   :.|.:.
  Fly   318 QPDVHICLTCNKEFKEAQFLHRHYSTKYHRKRVNLLV---NGPKEEFQSEVDPAEFPGYMEEGQA 379

  Fly   362 EAEADAFTIEVPLP-AEQEQDE 382
            |.|.:...::|.|. .::||.|
  Fly   380 EMEDNQAELDVMLDNIDEEQYE 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8159NP_649823.2 zf-AD 5..78 CDD:214871 22/76 (29%)
C2H2 Zn finger 194..214 CDD:275368 7/19 (37%)
COG5048 <197..322 CDD:227381 35/128 (27%)
zf-H2C2_2 206..231 CDD:290200 6/24 (25%)
C2H2 Zn finger 222..242 CDD:275368 6/20 (30%)
C2H2 Zn finger 250..270 CDD:275368 8/20 (40%)
zf-H2C2_2 265..287 CDD:290200 11/22 (50%)
C2H2 Zn finger 278..298 CDD:275368 6/19 (32%)
zf-H2C2_2 291..315 CDD:290200 5/25 (20%)
C2H2 Zn finger 306..328 CDD:275368 5/21 (24%)
OdjNP_650661.1 zf-AD 5..77 CDD:214871 20/71 (28%)
COG5048 <202..343 CDD:227381 39/141 (28%)
C2H2 Zn finger 209..229 CDD:275368 7/19 (37%)
C2H2 Zn finger 236..256 CDD:275368 5/19 (26%)
zf-H2C2_2 249..274 CDD:290200 7/24 (29%)
C2H2 Zn finger 265..283 CDD:275368 6/17 (35%)
C2H2 Zn finger 298..314 CDD:275368 4/15 (27%)
zf-C2H2_jaz 322..347 CDD:288983 5/24 (21%)
C2H2 Zn finger 324..343 CDD:275368 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.