DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8159 and CG17801

DIOPT Version :9

Sequence 1:NP_649823.2 Gene:CG8159 / 41040 FlyBaseID:FBgn0037619 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_650660.2 Gene:CG17801 / 42144 FlyBaseID:FBgn0038550 Length:381 Species:Drosophila melanogaster


Alignment Length:392 Identity:91/392 - (23%)
Similarity:148/392 - (37%) Gaps:100/392 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRVCASSTDNSKSLKLFNSGACKVLQQINLLTGVLLQCEPGLPDWMCETCQTDLKSAISFRDRCL 70
            |.:|||...:.....:|   ..:||.:|..|||:.|:.....|..:|.:|..||.::|..:.|. 
  Fly    10 CHLCASCFCHLNPTIIF---CLEVLAKIKDLTGIWLEQNERQPRHICPSCLNDLNTSIKLKKRI- 70

  Fly    71 RSQKIFEESLVRNE---EDTFRSSVRRSARSQRQRHEDTAPKTPASPLEVMIKLES----LSNGD 128
              |::..|:.:|.|   ::...|:|           .|..|:..:|.||.....:|    .....
  Fly    71 --QRVHNEATLRRESGLDEDLESTV-----------SDIEPEGDSSDLESEESYDSENYPFDKKA 122

  Fly   129 EEDD---GIDHLDSCNE------------------------------------------------ 142
            ||.|   .:.|.|..||                                                
  Fly   123 EESDIDLNLAHEDRRNEPHNPYDSETPLIFKHKNPLIETPSFANENLPNKVDAKSPKKGNFIQIG 187

  Fly   143 ADMEL--------AIKAMSSSTEDDGTTSPVRLKRTRRRGLKKGGKGENRTKVTLPVFFCDQCGN 199
            .|:.|        .:|.::.:.||....:....|||.|:               :....|.:||.
  Fly   188 TDLRLLTTYPSIKVVKPLALAPEDVAAENVPPAKRTARK---------------MQSLVCPKCGR 237

  Fly   200 NITGKSSFDRHLRKHSGIRPFQCELCPARFLSSGELKGHQ-VMHTGDRKFQCRYCDRTYVNYSGR 263
            ......:...|:.:|:|.:.|.|..|..||::....:.|: |.|.|::.|:|.:|..|:...:.:
  Fly   238 VFKTPYNLKTHMVRHTGEKNFPCTFCDKRFVTKYLARLHERVRHMGEQPFECNFCSATFFTSTAK 302

  Fly   264 LRHER-THTNDRPFICAQCGKSFTNSYILKNHMLIHTGERLFRCELCHRSFARPTHLKTHFRSNT 327
            ..||| .|..|..:.|.||.|.|.....|..|..:|:|.:.|.|.:|..:|||...|::||.|..
  Fly   303 SSHERIRHIRDLRYQCDQCTKRFNTKTCLNKHKFLHSGLKPFDCVICQINFARKATLRSHFDSVA 367

  Fly   328 HK 329
            |:
  Fly   368 HQ 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8159NP_649823.2 zf-AD 5..78 CDD:214871 20/71 (28%)
C2H2 Zn finger 194..214 CDD:275368 4/19 (21%)
COG5048 <197..322 CDD:227381 39/126 (31%)
zf-H2C2_2 206..231 CDD:290200 8/24 (33%)
C2H2 Zn finger 222..242 CDD:275368 6/20 (30%)
C2H2 Zn finger 250..270 CDD:275368 6/20 (30%)
zf-H2C2_2 265..287 CDD:290200 10/22 (45%)
C2H2 Zn finger 278..298 CDD:275368 7/19 (37%)
zf-H2C2_2 291..315 CDD:290200 8/23 (35%)
C2H2 Zn finger 306..328 CDD:275368 9/21 (43%)
CG17801NP_650660.2 zf-AD 9..74 CDD:285071 20/69 (29%)
zf-C2H2 231..252 CDD:278523 4/20 (20%)
C2H2 Zn finger 232..252 CDD:275368 4/19 (21%)
zf-H2C2_2 244..269 CDD:290200 8/24 (33%)
C2H2 Zn finger 260..281 CDD:275368 6/20 (30%)
C2H2 Zn finger 289..308 CDD:275368 5/18 (28%)
C2H2 Zn finger 318..338 CDD:275368 7/19 (37%)
C2H2 Zn finger 346..362 CDD:275368 6/15 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 1 1.100 - - P PTHR24388
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.