DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8159 and CG17806

DIOPT Version :9

Sequence 1:NP_649823.2 Gene:CG8159 / 41040 FlyBaseID:FBgn0037619 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster


Alignment Length:410 Identity:117/410 - (28%)
Similarity:181/410 - (44%) Gaps:81/410 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LQNVCRVCASSTDNSKSLKLFNSGACKVLQQINLLTGVLLQCEPGLPDWMCETCQTDLKSAISFR 66
            :..:||.|....:::||  ||:..|..||..|..|||..|:.:||:|..:|.:|..||..||:||
  Fly     1 MTTLCRTCGQEAEHAKS--LFDKEARDVLSNILKLTGFWLRNQPGVPTRICLSCLLDLNDAIAFR 63

  Fly    67 DRCLRSQKI-FEESLVRNEEDT----------FRSSV-----------RRSARSQRQRHEDTAP- 108
            :||:|:... ||:...:.:.||          ..|.|           ||....||.:..|..| 
  Fly    64 ERCIRTNSSWFEKQGKQEDSDTETAREGGNNRLESRVDVMPISIAQPQRRRILPQRSKKVDGVPL 128

  Fly   109 ---KTPASPL------------------EVMIKLESLSNGDEEDDGIDHLDSCNEADM------- 145
               :||..||                  .:.:|.|...:.|...:.::|.:..:|...       
  Fly   129 KTVETPIYPLVVPEIPPADLVDPLRCEDPIQVKSEPQLSSDYPVESMNHEEPASEMPQVMKEEPR 193

  Fly   146 ----------------------ELAIKAMSSSTEDDGTTSPVRLKRTRRRGLKKGGKGENRTKVT 188
                                  |...|.|:.....|.||:..:.::...|  .|.|..:....:.
  Fly   194 TLQVIGEVQKNRRKPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATR--NKWGAAKRAYALE 256

  Fly   189 LPVFFCDQCGNNITGKSSFDRHLRKHSGIRPFQCELCPARFLSSGELKGH-QVMHTGDRKFQCRY 252
            ..::||||||...:.|.:|:.|||:|.|.:.|||:.|.....:...|..| ::.|.|:..:.|:|
  Fly   257 HRLYFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKY 321

  Fly   253 CDRTYVNYSGRLRHERTHTND---RPFICAQCGKSFTNSYILKNHMLIHTGERLFRCELCHRSFA 314
            |.:.:.|...||.|||.|...   ||.:|:.|.|:|..|..||:|:::||||:.|.||||...|.
  Fly   322 CGKRFDNCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFN 386

  Fly   315 RPTHLKTHFRSNTHKHNLEK 334
            |...|.||::|..|:..:|:
  Fly   387 RRNALATHYKSKHHRLKVEE 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8159NP_649823.2 zf-AD 5..78 CDD:214871 30/73 (41%)
C2H2 Zn finger 194..214 CDD:275368 10/19 (53%)
COG5048 <197..322 CDD:227381 49/128 (38%)
zf-H2C2_2 206..231 CDD:290200 10/24 (42%)
C2H2 Zn finger 222..242 CDD:275368 4/20 (20%)
C2H2 Zn finger 250..270 CDD:275368 9/19 (47%)
zf-H2C2_2 265..287 CDD:290200 10/24 (42%)
C2H2 Zn finger 278..298 CDD:275368 8/19 (42%)
zf-H2C2_2 291..315 CDD:290200 13/23 (57%)
C2H2 Zn finger 306..328 CDD:275368 10/21 (48%)
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 30/73 (41%)
zf-C2H2 260..282 CDD:278523 11/21 (52%)
C2H2 Zn finger 262..282 CDD:275368 10/19 (53%)
C2H2 Zn finger 290..311 CDD:275368 4/20 (20%)
COG5048 <298..>383 CDD:227381 33/84 (39%)
C2H2 Zn finger 319..339 CDD:275368 9/19 (47%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
ZnF_U1 375..407 CDD:197732 13/32 (41%)
C2H2 Zn finger 378..396 CDD:275368 9/17 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.