DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8159 and CG31388

DIOPT Version :9

Sequence 1:NP_649823.2 Gene:CG8159 / 41040 FlyBaseID:FBgn0037619 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster


Alignment Length:437 Identity:106/437 - (24%)
Similarity:167/437 - (38%) Gaps:122/437 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LQNVCRVCASSTDNSKSLKLFNSGACKVLQQINLLTGVLLQCEPGLPDWMCETCQTDLKSAISFR 66
            ::.:||.|:...|.:.:..||:..:..||:||..||.:.|:.:..||.:||:.||.||:.||.||
  Fly     1 MRYICRTCSRMADPAVAKNLFDPSSSSVLRQIETLTNLQLKEDGKLPRFMCQDCQHDLQIAIDFR 65

  Fly    67 DRCLRSQKIFEESL--VRNEEDTFRSSVRR--------------------------SARSQRQRH 103
            ..|:.:|::.|..|  |..||:.|.|...:                          ....|.:..
  Fly    66 RVCIEAQELLELQLRQVEKEEEAFESLAEQWLDDCPDELSNLSPVLQLNDRMDFIFDPEPQDKNT 130

  Fly   104 EDTAPKTPASPLEVMIKLES---------------LSN----------GDEEDDGIDHLD----- 138
            ::.|.....:..|.|...:|               |||          .:.|.:.||:.|     
  Fly   131 DELASIKTTTTTEYMNAYQSVASPQSSPELSTDSQLSNEHFDMGLSPESEPESEAIDNRDTSSSH 195

  Fly   139 SCNEADMELA-----------IKAMSSSTE------DDGTTSPVRLKRTRRRGLKKGGKGENRTK 186
            :|::..:|..           :..:...|:      |:|..|...|.|             :...
  Fly   196 TCSKCGLEFENVDELKLHKYHLHDIPPDTKFVCDHCDEGFRSAAALTR-------------HCNM 247

  Fly   187 VTLPV-------------------------------FFCDQCGNNITGKSSFDRHLRKHSGIRPF 220
            :.||:                               ..|..||.::|...:...||.:|:|.|..
  Fly   248 INLPLTHSCTKCKSQFHNHILLETHKQRCLRPPASQHVCHICGKHLTTAFNLKNHLVRHAGTRRH 312

  Fly   221 QCELCPARFLSSGELKGHQVMHTGDRKFQCRY-CDRTYVNYSGRLRHERTH--TNDRPFICAQCG 282
            :|:.|.|.|.::.||..||..||.:|.:.||| |.:|:...|.|..|||.|  .:.|.:.|..|.
  Fly   313 KCDQCSASFYTAAELCSHQKTHTTERPYICRYNCGKTFRFCSARSMHERVHMDASKRIYQCEYCP 377

  Fly   283 KSFTNSYILKNHMLIHTGERLFRCELCHRSFARPTHLKTHFRSNTHK 329
            ||:......:.|...|...|...||:|..||....|.::|.:||.||
  Fly   378 KSYVTPSECRTHQKYHNLTRDHGCEICRISFKTAKHYRSHLKSNAHK 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8159NP_649823.2 zf-AD 5..78 CDD:214871 27/72 (38%)
C2H2 Zn finger 194..214 CDD:275368 6/19 (32%)
COG5048 <197..322 CDD:227381 44/127 (35%)
zf-H2C2_2 206..231 CDD:290200 9/24 (38%)
C2H2 Zn finger 222..242 CDD:275368 8/19 (42%)
C2H2 Zn finger 250..270 CDD:275368 10/20 (50%)
zf-H2C2_2 265..287 CDD:290200 9/23 (39%)
C2H2 Zn finger 278..298 CDD:275368 5/19 (26%)
zf-H2C2_2 291..315 CDD:290200 8/23 (35%)
C2H2 Zn finger 306..328 CDD:275368 9/21 (43%)
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 27/71 (38%)
C2H2 Zn finger 228..254 CDD:275368 7/38 (18%)
C2H2 Zn finger 286..306 CDD:275368 6/19 (32%)
C2H2 Zn finger 314..334 CDD:275368 8/19 (42%)
C2H2 Zn finger 342..363 CDD:275368 10/20 (50%)
C2H2 Zn finger 373..393 CDD:275368 5/19 (26%)
C2H2 Zn finger 401..419 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.