DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8159 and CG14667

DIOPT Version :9

Sequence 1:NP_649823.2 Gene:CG8159 / 41040 FlyBaseID:FBgn0037619 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster


Alignment Length:359 Identity:101/359 - (28%)
Similarity:158/359 - (44%) Gaps:55/359 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LQNVCRVCASS-TDNSKSLKLFNSGACKVLQQINLLTGVLLQCEPGLPDWMCETCQTDLKSAISF 65
            |.:|||:||:. ..:.:...:|.....|.|.|:.|:|||.|....|||:.:||.|.::|..|..|
  Fly     3 LADVCRICANKIMGHQRDRNIFIHMRGKYLGQLKLITGVELTRNQGLPEIVCERCFSELDLATKF 67

  Fly    66 RDRCLRSQKIFEESLVRNEEDTFRSSVRRSARSQRQRHEDTAPKTPASPL-EVMIKLESLSNGDE 129
            |:||:.|||...: :::...|  :|:|.....|:              || |.:|..:.|....:
  Fly    68 RERCIFSQKYLLD-IIKKTSD--QSTVHVELSSE--------------PLDEQLIDADQLETHYD 115

  Fly   130 EDDGI-------DH-------LDSCNEADMELAIKAMSSSTEDDGTTSPVRLKRTRRRGLKKGGK 180
            :|..:       :|       ||....|.:..|.:|.:.:.:.:........:..:||.      
  Fly   116 DDQYVCYQGTKEEHQDLEEIELDDDPSAAVIAAAEAAAEAAQQEDLQEQEMERAAKRRS------ 174

  Fly   181 GENRTKVTLPVFFCDQCGNNITGKSSFDRHLRKHSGIRP----FQCELCPARFLSSGELKGHQV- 240
                     ..|.||:||........:..||..|...|.    |.|..||..|.....||.|:. 
  Fly   175 ---------NFFICDECGTLFHDAFLYTEHLNGHQNRRDMNQFFPCPECPQTFNKKALLKQHRTQ 230

  Fly   241 MHTGDRKFQCRYCDRTYVNYSGRLRHERTHTNDRPFICAQCGKSFTNSYILKNHMLIHTGE-RLF 304
            :|..:|:|||..|...:.:...:|||::.|.|:||:.|.:||..|::...|:||...|:.: |.|
  Fly   231 VHLINRRFQCTICHEAFASLGAKLRHDKAHKNERPYPCLECGMIFSSVSELQNHFSTHSKQIRKF 295

  Fly   305 RCELCHRSFARPTHLKTHFRSNTHKHNLEKSMAD 338
            |||.|:..|.....|..|.::..|| .|.|.|.|
  Fly   296 RCEPCNMDFITRRGLVAHTKTAPHK-RLAKYMQD 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8159NP_649823.2 zf-AD 5..78 CDD:214871 29/73 (40%)
C2H2 Zn finger 194..214 CDD:275368 6/19 (32%)
COG5048 <197..322 CDD:227381 43/130 (33%)
zf-H2C2_2 206..231 CDD:290200 9/28 (32%)
C2H2 Zn finger 222..242 CDD:275368 7/20 (35%)
C2H2 Zn finger 250..270 CDD:275368 5/19 (26%)
zf-H2C2_2 265..287 CDD:290200 10/21 (48%)
C2H2 Zn finger 278..298 CDD:275368 7/19 (37%)
zf-H2C2_2 291..315 CDD:290200 11/24 (46%)
C2H2 Zn finger 306..328 CDD:275368 6/21 (29%)
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 29/73 (40%)
C2H2 Zn finger 179..199 CDD:275368 6/19 (32%)
C2H2 Zn finger 211..232 CDD:275368 7/20 (35%)
C2H2 Zn finger 240..260 CDD:275368 5/19 (26%)
zf-C2H2_8 243..313 CDD:292531 24/69 (35%)
C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
C2H2 Zn finger 297..316 CDD:275368 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.