DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8159 and CG11906

DIOPT Version :9

Sequence 1:NP_649823.2 Gene:CG8159 / 41040 FlyBaseID:FBgn0037619 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_611402.2 Gene:CG11906 / 37209 FlyBaseID:FBgn0034425 Length:634 Species:Drosophila melanogaster


Alignment Length:395 Identity:81/395 - (20%)
Similarity:127/395 - (32%) Gaps:137/395 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DWMCETCQT-------DLKSAISFRDRCLRSQKIFEESLVRN---------------EEDTFRSS 91
            |..|..|..       ||:|....:.|..|..||..: ::|:               ..:..||.
  Fly    43 DANCTVCGAAKASALLDLRSNHVMQRRLSRDWKIHAD-VIRSTLKAICVECVCKLNMHSEVTRSL 106

  Fly    92 VRRSARSQRQRHEDTAPKT----------PASPLEVMIKL-ESLSNGDEEDDGIDHLDSCNEADM 145
            ::|..|.||...|.|...|          |.:..||...| ||..........:....||:..::
  Fly   107 MQRMQRLQRSGGETTKVTTTTTSPSQHSPPIADAEVSTTLIESQEEVAHSGQSVRSRSSCSVLEV 171

  Fly   146 ELAIKAMSSSTEDDGTTSPVRLKRTRRRGLKKGGKGENRTKVTLPVFFCDQCGNNITGKSSFDRH 210
            .||.:..|.|.           |.|..:. .:|.|...|.:       |.:||.....:..:.:|
  Fly   172 YLAQQPYSPSA-----------KETEEKH-AEGWKWRTRLE-------CHECGRAYFRRDYYAQH 217

  Fly   211 LRKHSGIRPFQ-------C---------ELCPARFLSSGELKGHQVMHTGDRKFQCRYCDRTYVN 259
            ||:.|..|..|       |         |..|:|.:.|            .|.:.||:||..:..
  Fly   218 LRRCSKTRRKQPRPSRVKCRVLNEASYDEEAPSRAIRS------------SRIYYCRHCDAEFET 270

  Fly   260 YSGRLRHERTHTNDRPFICAQCGKSFTNSYILKNHMLIHTGERLFRCELCHRSFARPTHLKTHFR 324
            ...:.:|||.....|                             :.|:||.      ..|.|.:.
  Fly   271 LISKRQHERMKHQQR-----------------------------YPCDLCE------AQLDTKYE 300

  Fly   325 SNTHKHNLEKSMADAGGVQLSPSQSADQVKFVTEKEPEA-----------EA-DAFTIEVPLPAE 377
            ...| |.:.::..:|  :.:...|.|.|. .:|.:.|.|           || |.:.::     |
  Fly   301 WEMH-HTICQAKQEA--LAIVEQQEAGQT-VMTSRVPRACSMRSRSRACSEAWDRYDMD-----E 356

  Fly   378 QEQDE 382
            :|:||
  Fly   357 EEEDE 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8159NP_649823.2 zf-AD 5..78 CDD:214871 10/35 (29%)
C2H2 Zn finger 194..214 CDD:275368 6/19 (32%)
COG5048 <197..322 CDD:227381 26/140 (19%)
zf-H2C2_2 206..231 CDD:290200 10/40 (25%)
C2H2 Zn finger 222..242 CDD:275368 5/28 (18%)
C2H2 Zn finger 250..270 CDD:275368 7/19 (37%)
zf-H2C2_2 265..287 CDD:290200 4/21 (19%)
C2H2 Zn finger 278..298 CDD:275368 0/19 (0%)
zf-H2C2_2 291..315 CDD:290200 3/23 (13%)
C2H2 Zn finger 306..328 CDD:275368 5/21 (24%)
CG11906NP_611402.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.