DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8159 and cg

DIOPT Version :9

Sequence 1:NP_649823.2 Gene:CG8159 / 41040 FlyBaseID:FBgn0037619 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001097306.2 Gene:cg / 36571 FlyBaseID:FBgn0000289 Length:837 Species:Drosophila melanogaster


Alignment Length:217 Identity:60/217 - (27%)
Similarity:97/217 - (44%) Gaps:35/217 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 VMIKLESLSNGDEEDDGIDHLDSCNEA--------DMELAIKA-MSSSTEDDGTTSPVRLKRTRR 172
            :.::::.:..|.|:::     ||..||        .:||:.|. :..|.....|.:.::.:|.  
  Fly   234 ISVQVQKVIQGLEDNE-----DSQGEAPNLKLEPGTLELSPKTELQESMHFSETDATIKKERP-- 291

  Fly   173 RGLKKGGKGENRTKVTLPVFFCDQCGNNITGKSSFDRHLRKHSGIRPFQCELCPARFLSSGELKG 237
                               :.||:||.:...|.....|.|.|:|.||..|..|...|.....|..
  Fly   292 -------------------YSCDECGKSFLLKHHLTTHARVHTGERPHICTHCGKSFAHKHCLNT 337

  Fly   238 HQVMHTGDRKFQCRYCDRTYVNYSGRLRHERTHTNDRPFICAQCGKSFTNSYILKNHMLIHTGER 302
            |.::|:.:|.:||:.|.:::......|.|.|.|:.:|||:|.:||::|.....|..|...|.|||
  Fly   338 HLLLHSTERPYQCQECKKSFTLKHHLLTHSRVHSRERPFVCQECGRAFPLKRHLVTHSKFHAGER 402

  Fly   303 LFRCELCHRSFARPTHLKTHFR 324
            .:.||.|..|||:..||..|.|
  Fly   403 PYVCEECGESFAQENHLIMHSR 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8159NP_649823.2 zf-AD 5..78 CDD:214871
C2H2 Zn finger 194..214 CDD:275368 7/19 (37%)
COG5048 <197..322 CDD:227381 44/124 (35%)
zf-H2C2_2 206..231 CDD:290200 9/24 (38%)
C2H2 Zn finger 222..242 CDD:275368 5/19 (26%)
C2H2 Zn finger 250..270 CDD:275368 5/19 (26%)
zf-H2C2_2 265..287 CDD:290200 10/21 (48%)
C2H2 Zn finger 278..298 CDD:275368 6/19 (32%)
zf-H2C2_2 291..315 CDD:290200 11/23 (48%)
C2H2 Zn finger 306..328 CDD:275368 10/19 (53%)
cgNP_001097306.2 COG5048 287..>371 CDD:227381 25/104 (24%)
C2H2 Zn finger 294..314 CDD:275368 7/19 (37%)
zf-H2C2_2 306..331 CDD:290200 9/24 (38%)
C2H2 Zn finger 322..342 CDD:275368 5/19 (26%)
C2H2 Zn finger 350..370 CDD:275368 5/19 (26%)
zf-H2C2_2 362..385 CDD:290200 10/22 (45%)
C2H2 Zn finger 378..398 CDD:275368 6/19 (32%)
zf-H2C2_2 390..415 CDD:290200 11/24 (46%)
C2H2 Zn finger 406..426 CDD:275368 10/19 (53%)
SIR2 <425..>465 CDD:294129 60/217 (28%)
C2H2 Zn finger 434..454 CDD:275368
C2H2 Zn finger 461..482 CDD:275368
C2H2 Zn finger 490..509 CDD:275368
lambda-1 491..>603 CDD:212564
C2H2 Zn finger 575..595 CDD:275368
C2H2 Zn finger 720..740 CDD:275368
C2H2 Zn finger 752..771 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.