| Sequence 1: | NP_649823.2 | Gene: | CG8159 / 41040 | FlyBaseID: | FBgn0037619 | Length: | 399 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_476732.1 | Gene: | sna / 34908 | FlyBaseID: | FBgn0003448 | Length: | 390 | Species: | Drosophila melanogaster |
| Alignment Length: | 245 | Identity: | 65/245 - (26%) |
|---|---|---|---|
| Similarity: | 95/245 - (38%) | Gaps: | 23/245 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 90 SSVRRSARSQRQRHEDTAPKTPASPLEVMIKLESLS-NGDEEDDGIDHLDSCNEADMELAIKAMS 153
Fly 154 SSTEDDGTTSPVRLKRTRRRGLKKGGKGENRTKVTLPVFFCDQCGNNITGKSSFDRHLRKHSGI- 217
Fly 218 ------RPFQCELCPARFLSSGELKGHQVMHTGDRKFQCRYCDRTYVNYSGRLRHERTHTNDRPF 276
Fly 277 ICAQCGKSFTNSYILKNHMLIHTGERLFRCELCHRSFARPTHLKTHFRSN 326 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG8159 | NP_649823.2 | zf-AD | 5..78 | CDD:214871 | |
| C2H2 Zn finger | 194..214 | CDD:275368 | 4/19 (21%) | ||
| COG5048 | <197..322 | CDD:227381 | 36/131 (27%) | ||
| zf-H2C2_2 | 206..231 | CDD:290200 | 5/31 (16%) | ||
| C2H2 Zn finger | 222..242 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 250..270 | CDD:275368 | 4/19 (21%) | ||
| zf-H2C2_2 | 265..287 | CDD:290200 | 11/21 (52%) | ||
| C2H2 Zn finger | 278..298 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 291..315 | CDD:290200 | 8/23 (35%) | ||
| C2H2 Zn finger | 306..328 | CDD:275368 | 10/21 (48%) | ||
| sna | NP_476732.1 | C2H2 Zn finger | 308..328 | CDD:275368 | 4/19 (21%) |
| zf-H2C2_2 | 321..344 | CDD:290200 | 10/22 (45%) | ||
| zf-C2H2 | 334..356 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 336..356 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 348..373 | CDD:290200 | 8/24 (33%) | ||
| C2H2 Zn finger | 364..380 | CDD:275368 | 7/15 (47%) | ||
| C2H2 Zn finger | 247..267 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 282..302 | CDD:275368 | 7/19 (37%) | ||
| zf-C2H2 | 306..328 | CDD:278523 | 5/23 (22%) | ||
| COG5048 | 307..>356 | CDD:227381 | 16/50 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR24388 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||