DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8159 and Cf2

DIOPT Version :9

Sequence 1:NP_649823.2 Gene:CG8159 / 41040 FlyBaseID:FBgn0037619 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster


Alignment Length:346 Identity:83/346 - (23%)
Similarity:123/346 - (35%) Gaps:109/346 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 RSQKIFEESLVRNEEDTFRSSVRRSARSQRQRHEDTAPKTPASPL-----------------EVM 118
            :.|::.|:.....:|...:..|....:.|....:..|.|.|  ||                 :|:
  Fly   250 QQQELLEQQQREMQEQAQQQQVHHHQQDQDLAGDQVALKVP--PLTVKLNKNANGGAIVSHPQVI 312

  Fly   119 IKLESLSNGDEEDDGIDHLDSCNEADMELAIKAMSSSTEDDGTTSPVRLKRTRRRGLKKGGKGEN 183
            ||.|.||..|..       |..|...: .||:|      :.|..:|.      ..|:..|.:   
  Fly   313 IKEEPLSLSDSG-------DVVNSVPV-YAIQA------NPGVPAPA------SSGVLVGTQ--- 354

  Fly   184 RTKVTLPVFFCDQCGNNITGKSSFDRHLRKHSGIRPFQCELCPARFLSSGELKGHQVMHTG---- 244
                |:|....               |..:|      :|..||..|.:.|.|..|:.:|||    
  Fly   355 ----TVPADLA---------------HKIRH------KCPDCPKTFKTPGTLAMHRKIHTGEADA 394

  Fly   245 ---DRKFQCRYCDRTYVNYSGRLRHERTHTNDRPFICAQCGKSFTNSYILKNHMLIHTGERLFRC 306
               :|.:.|.||.:::...:...:|.|.||.::||.|..|.|||:....|..|:..||||:.:.|
  Fly   395 TPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTC 459

  Fly   307 ELCHRSFARPTHLKTHFRSNTHKHNLEKSMADAGGVQL----------------------SPSQS 349
            ..|.:.|.:.:.|..|   .|..|.|   ....||.||                      .|..|
  Fly   460 PYCDKRFTQRSALTVH---TTKLHPL--XGRPGGGRQLPVPAPAAPPPPTHPPNPSGPGAPPPLS 519

  Fly   350 ADQVKFVTE---KEPEAEADA 367
            ||     |:   |:|.|.|.|
  Fly   520 AD-----TDTDPKKPSAAAAA 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8159NP_649823.2 zf-AD 5..78 CDD:214871 1/6 (17%)
C2H2 Zn finger 194..214 CDD:275368 1/19 (5%)
COG5048 <197..322 CDD:227381 37/131 (28%)
zf-H2C2_2 206..231 CDD:290200 6/24 (25%)
C2H2 Zn finger 222..242 CDD:275368 7/19 (37%)
C2H2 Zn finger 250..270 CDD:275368 5/19 (26%)
zf-H2C2_2 265..287 CDD:290200 11/21 (52%)
C2H2 Zn finger 278..298 CDD:275368 7/19 (37%)
zf-H2C2_2 291..315 CDD:290200 9/23 (39%)
C2H2 Zn finger 306..328 CDD:275368 5/21 (24%)
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 35/112 (31%)
C2H2 Zn finger 368..388 CDD:275368 7/19 (37%)
C2H2 Zn finger 403..423 CDD:275368 5/19 (26%)
C2H2 Zn finger 431..451 CDD:275368 7/19 (37%)
zf-H2C2_2 443..468 CDD:316026 9/24 (38%)
C2H2 Zn finger 459..480 CDD:275368 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.