DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8159 and Zfp189

DIOPT Version :9

Sequence 1:NP_649823.2 Gene:CG8159 / 41040 FlyBaseID:FBgn0037619 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001101400.1 Gene:Zfp189 / 313219 RGDID:1306510 Length:608 Species:Rattus norvegicus


Alignment Length:247 Identity:75/247 - (30%)
Similarity:117/247 - (47%) Gaps:21/247 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 RHEDTAPKTPASPLEVMIKLESL------SNGDEEDDGIDHLDSCNEADMELAIKAMSSSTEDDG 160
            |:||..| |....:|..|:.:.:      |..|::..|.:..:.....|.:..|  .......|.
  Rat    44 RNEDEEP-TVKEEIEKDIEPQGIIVTRIKSELDQDPMGSETFELVGRLDKQRGI--FLWEIPRDS 105

  Fly   161 TTSPVRLKRTRRRGLKKGGKGENRTKVTLPVFFCDQCGNNITGKSSFDRHLRKHSGIRPFQCELC 225
            .|...::.|......|:....|...|       |::||.....|:.|.:|.|.|:|.:||||..|
  Rat   106 LTEEQKMFRGHTNVRKRPNSEEKCHK-------CEECGKRFVRKAHFIQHQRVHTGEKPFQCNEC 163

  Fly   226 PARFLSSGELKGHQVMHTGDRKFQCRYCDRTYVNYSGRLRHERTHTNDRPFICAQCGKSFTNSYI 290
            ...|..|..:..||.:|||:|.::|.||.:|:...|..:||:|.||.:||:.|.||.:||:....
  Rat   164 GKSFSRSSFVIEHQRIHTGERPYECNYCGKTFSVSSTLIRHQRIHTGERPYQCNQCKQSFSQRRS 228

  Fly   291 LKNHMLIHTGERLFRCELCHRSFARPTHLKTHFRSNT-----HKHNLEKSMA 337
            |..|..|||||:..:|..|.::|:..:||..|.|::|     |....:||.:
  Rat   229 LVKHQRIHTGEKPHKCSDCGKAFSWKSHLIEHQRTHTGEKPYHCTKCKKSFS 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8159NP_649823.2 zf-AD 5..78 CDD:214871
C2H2 Zn finger 194..214 CDD:275368 7/19 (37%)
COG5048 <197..322 CDD:227381 50/124 (40%)
zf-H2C2_2 206..231 CDD:290200 11/24 (46%)
C2H2 Zn finger 222..242 CDD:275368 6/19 (32%)
C2H2 Zn finger 250..270 CDD:275368 8/19 (42%)
zf-H2C2_2 265..287 CDD:290200 12/21 (57%)
C2H2 Zn finger 278..298 CDD:275368 7/19 (37%)
zf-H2C2_2 291..315 CDD:290200 10/23 (43%)
C2H2 Zn finger 306..328 CDD:275368 8/26 (31%)
Zfp189NP_001101400.1 KRAB_A-box <10..39 CDD:143639
COG5048 116..506 CDD:227381 60/172 (35%)
C2H2 Zn finger 132..152 CDD:275368 7/19 (37%)
zf-H2C2_2 144..169 CDD:290200 11/24 (46%)
C2H2 Zn finger 160..180 CDD:275368 6/19 (32%)
zf-H2C2_2 175..196 CDD:290200 10/20 (50%)
C2H2 Zn finger 188..208 CDD:275368 8/19 (42%)
zf-H2C2_2 201..225 CDD:290200 12/23 (52%)
C2H2 Zn finger 216..236 CDD:275368 7/19 (37%)
zf-H2C2_2 228..252 CDD:290200 9/23 (39%)
C2H2 Zn finger 244..264 CDD:275368 7/19 (37%)
zf-H2C2_2 256..281 CDD:290200 8/25 (32%)
C2H2 Zn finger 272..292 CDD:275368 2/9 (22%)
zf-H2C2_2 285..307 CDD:290200
C2H2 Zn finger 300..320 CDD:275368
zf-H2C2_2 312..337 CDD:290200
C2H2 Zn finger 328..348 CDD:275368
zf-H2C2_2 341..365 CDD:290200
C2H2 Zn finger 356..376 CDD:275368
zf-H2C2_2 368..393 CDD:290200
C2H2 Zn finger 384..404 CDD:275368
C2H2 Zn finger 440..460 CDD:275368
zf-H2C2_2 452..477 CDD:290200
C2H2 Zn finger 468..488 CDD:275368
zf-H2C2_2 481..505 CDD:290200
C2H2 Zn finger 496..516 CDD:275368
zf-H2C2_2 508..533 CDD:290200
C2H2 Zn finger 524..544 CDD:275368
zf-H2C2_2 537..561 CDD:290200
C2H2 Zn finger 552..572 CDD:275368
C2H2 Zn finger 583..603 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.