DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8159 and ZNF281

DIOPT Version :9

Sequence 1:NP_649823.2 Gene:CG8159 / 41040 FlyBaseID:FBgn0037619 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001268222.1 Gene:ZNF281 / 23528 HGNCID:13075 Length:895 Species:Homo sapiens


Alignment Length:384 Identity:83/384 - (21%)
Similarity:143/384 - (37%) Gaps:89/384 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PGLPDWMCETCQTDLKSAISFRDRCLRSQKIFEESLVRNEEDTFRSSVRRSARSQRQRH------ 103
            |..||...:  :....||.:|..:  |:...|.:|||..:::.......:.:......|      
Human    93 PPAPDMTFK--KEPAASAAAFPSQ--RTSWGFLQSLVSIKQEKPADPEEQQSHHHHHHHHYGGLF 153

  Fly   104 ---EDTAPKTPASPLEVMIKLESLSNGDEEDDGI--------DHLDSCNEADMELAIKAMSSSTE 157
               |:.:|              .|..|:....|:        .|:.. ..|.....:...|||..
Human   154 AGAEERSP--------------GLGGGEGGSHGVIQDLSILHQHVQQ-QPAQHHRDVLLSSSSRT 203

  Fly   158 DD--GTTSP---VRLKRTRR-----RGLKKGGKGENRTKVTLPVFFCDQCGNNITGKSSFDRHLR 212
            ||  ||..|   ..:|:.:|     :|:|...|....:|   |....|..|..::...       
Human   204 DDHHGTEEPKQDTNVKKAKRPKPESQGIKAKRKPSASSK---PSLVGDGEGAILSPSQ------- 258

  Fly   213 KHSGIRPFQCELCPARFLSSGELKGHQVMHTGDRKFQCRYCDRTYVNYSGRLRHERTHTNDRPFI 277
                 :|..|:.|.|.|.||..|:.|.::|||:|.|||..|...::......|||:.|:.::||.
Human   259 -----KPHICDHCSAAFRSSYHLRRHVLIHTGERPFQCSQCSMGFIQKYLLQRHEKIHSREKPFG 318

  Fly   278 CAQCGKSFTNSYILKNHMLIHTGERLFRCELCHRSFARPTHLKTHFR----------------SN 326
            |.||...|...|.::.|...|:||:.::|:.|.:.|:|...|..|.|                |:
Human   319 CDQCSMKFIQKYHMERHKRTHSGEKPYKCDTCQQYFSRTDRLLKHRRTCGEVIVKGATSAEPGSS 383

  Fly   327 THKHNLEKSMADAGGVQLSPSQSADQVKFVTEKEPEA------------EADAFTIEVP 373
            .|.:....::...|....|..::..:...:..||.:.            ...::::|:|
Human   384 NHTNMGNLAVLSQGNTSSSRRKTKSKSIAIENKEQKTGKTNESQISNNINMQSYSVEMP 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8159NP_649823.2 zf-AD 5..78 CDD:214871 8/32 (25%)
C2H2 Zn finger 194..214 CDD:275368 2/19 (11%)
COG5048 <197..322 CDD:227381 38/124 (31%)
zf-H2C2_2 206..231 CDD:290200 5/24 (21%)
C2H2 Zn finger 222..242 CDD:275368 8/19 (42%)
C2H2 Zn finger 250..270 CDD:275368 5/19 (26%)
zf-H2C2_2 265..287 CDD:290200 10/21 (48%)
C2H2 Zn finger 278..298 CDD:275368 6/19 (32%)
zf-H2C2_2 291..315 CDD:290200 7/23 (30%)
C2H2 Zn finger 306..328 CDD:275368 8/37 (22%)
ZNF281NP_001268222.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..113 6/21 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 130..149 1/18 (6%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 183..253 19/73 (26%)
C2H2 Zn finger 263..283 CDD:275368 8/19 (42%)
zf-H2C2_2 275..300 CDD:316026 10/24 (42%)
C2H2 Zn finger 291..311 CDD:275368 5/19 (26%)
zf-H2C2_2 304..328 CDD:316026 10/23 (43%)
C2H2 Zn finger 319..339 CDD:275368 6/19 (32%)
zf-H2C2_2 331..356 CDD:316026 7/24 (29%)
C2H2 Zn finger 347..366 CDD:275368 6/18 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 377..427 6/49 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 638..660
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 778..817
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.