DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8159 and klf-3

DIOPT Version :9

Sequence 1:	NP_649823.2	Gene:	CG8159 / 41040	FlyBaseID:	FBgn0037619	Length:	399	Species:	Drosophila melanogaster
Sequence 2:	NP_001022205.1	Gene:	klf-3 / 191713	WormBaseID:	WBGene00003480	Length:	315	Species:	Caenorhabditis elegans

Alignment Length:	90	Identity:	37/90 - (41%)
Similarity:	49/90 - (54%)	Gaps:	7/90 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   245 DRKF---QCRY--CDRTYVNYSGRLRHERTHTNDRPFIC--AQCGKSFTNSYILKNHMLIHTGER 302
            |:||   .|.|  |.:.|...|....|||||:.::||:|  ..|...|..|..|..||..|||::
Worm   224 DKKFVVHACTYPGCFKKYSKSSHLKAHERTHSGEKPFVCKWQNCSWKFARSDELTRHMRKHTGDK 288

  Fly   303 LFRCELCHRSFARPTHLKTHFRSNT 327
            .|||.||.|:|||..||..|.:.::
Worm   289 PFRCSLCDRNFARSDHLSLHMKRHS 313

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8159	NP_649823.2	zf-AD	5..78	CDD:214871
		C2H2 Zn finger	194..214	CDD:275368
		COG5048	<197..322	CDD:227381	36/83 (43%)
		zf-H2C2_2	206..231	CDD:290200
		C2H2 Zn finger	222..242	CDD:275368
		C2H2 Zn finger	250..270	CDD:275368	8/21 (38%)
		zf-H2C2_2	265..287	CDD:290200	10/23 (43%)
		C2H2 Zn finger	278..298	CDD:275368	7/21 (33%)
		zf-H2C2_2	291..315	CDD:290200	13/23 (57%)
		C2H2 Zn finger	306..328	CDD:275368	10/22 (45%)
klf-3	NP_001022205.1	C2H2 Zn finger	235..254	CDD:275368	6/18 (33%)
		C2H2 Zn finger	262..284	CDD:275368	7/21 (33%)
		zf-H2C2_2	276..301	CDD:290200	13/24 (54%)
		C2H2 Zn finger	292..312	CDD:275368	10/19 (53%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000