Sequence 1: | NP_649823.2 | Gene: | CG8159 / 41040 | FlyBaseID: | FBgn0037619 | Length: | 399 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001023313.1 | Gene: | M03D4.4 / 177375 | WormBaseID: | WBGene00019751 | Length: | 505 | Species: | Caenorhabditis elegans |
Alignment Length: | 271 | Identity: | 72/271 - (26%) |
---|---|---|---|
Similarity: | 112/271 - (41%) | Gaps: | 46/271 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 97 RSQRQRHEDTAPKTPASPLEVMIKLESLSNGDEEDDGIDHLDSCNEADMELAIKAMSSSTEDDGT 161
Fly 162 TSPVRLKRTRRRGLKKGGKGENRTKVTLPVFFCDQCGNNITGKSSFDRHLRKHSGIRPFQCELCP 226
Fly 227 ARFLSSGELKGHQVMHTGDRKFQCRYCDRTYVNYSGRLRHERTHTNDRPFICAQCGKSFTNSYIL 291
Fly 292 KNHMLIHTGERLFRCELCHRSFARPT-----HLKTHFRSNTHKHNLEKSMADAGGVQLSPSQSAD 351
Fly 352 QVKFVTEKEPE 362 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8159 | NP_649823.2 | zf-AD | 5..78 | CDD:214871 | |
C2H2 Zn finger | 194..214 | CDD:275368 | 5/19 (26%) | ||
COG5048 | <197..322 | CDD:227381 | 45/129 (35%) | ||
zf-H2C2_2 | 206..231 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 222..242 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 250..270 | CDD:275368 | 3/19 (16%) | ||
zf-H2C2_2 | 265..287 | CDD:290200 | 9/21 (43%) | ||
C2H2 Zn finger | 278..298 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 291..315 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 306..328 | CDD:275368 | 8/26 (31%) | ||
M03D4.4 | NP_001023313.1 | C2H2 Zn finger | 90..110 | CDD:275368 | 5/19 (26%) |
zf-H2C2_2 | 102..127 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 118..138 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 146..166 | CDD:275368 | 3/19 (16%) | ||
zf-H2C2_2 | 158..181 | CDD:290200 | 8/22 (36%) | ||
zf-C2H2 | 172..194 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 174..194 | CDD:275368 | 8/19 (42%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |