DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8159 and Zfp369

DIOPT Version :9

Sequence 1:	NP_649823.2	Gene:	CG8159 / 41040	FlyBaseID:	FBgn0037619	Length:	399	Species:	Drosophila melanogaster
Sequence 2:	NP_848141.3	Gene:	Zfp369 / 170936	MGIID:	2176229	Length:	845	Species:	Mus musculus

Alignment Length:	141	Identity:	52/141 - (36%)
Similarity:	76/141 - (53%)	Gaps:	2/141 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   194 CDQCGNNITGKSSFDRHLRKHSGIRPFQCELCPARFLSSGELKGHQVMHTGDRKFQCRYCDRTYV 258
            |.:||........|..|.:.|:|.||:.|..|...|:.|..|..|..:|:|:|.|:|..|.||:.
Mouse   703 CSECGKMFRNARYFSVHKKIHTGERPYMCMSCGKAFVQSSSLTQHLRIHSGERPFECSECGRTFS 767

  Fly   259 NYSGRLRHERTHTNDRPFICAQCGKSFTNSYILKNHMLIHTGERLFRCELCHRSFARPTHLKTHF 323
            :.|...:|.||||..:|:.|..|||:|..|..|..|:.||||||.:.|..|.::|.:.::|..|
Mouse   768 DRSAASQHLRTHTGAKPYQCQHCGKAFRQSSHLTRHVRIHTGERPYVCTKCGKAFTQSSNLIGH- 831

  Fly   324 RSNTHKHNLEK 334
             ..||:...:|
Mouse   832 -QKTHRKKFKK 841

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8159	NP_649823.2	zf-AD	5..78	CDD:214871
		C2H2 Zn finger	194..214	CDD:275368	5/19 (26%)
		COG5048	<197..322	CDD:227381	47/124 (38%)
		zf-H2C2_2	206..231	CDD:290200	9/24 (38%)
		C2H2 Zn finger	222..242	CDD:275368	6/19 (32%)
		C2H2 Zn finger	250..270	CDD:275368	7/19 (37%)
		zf-H2C2_2	265..287	CDD:290200	11/21 (52%)
		C2H2 Zn finger	278..298	CDD:275368	8/19 (42%)
		zf-H2C2_2	291..315	CDD:290200	11/23 (48%)
		C2H2 Zn finger	306..328	CDD:275368	5/21 (24%)
Zfp369	NP_848141.3	KRAB	35..94	CDD:214630
		KRAB	35..74	CDD:279668
		SCAN	179..266	CDD:280241
		KRAB	300..>340	CDD:214630
		KRAB	300..339	CDD:279668
		C2H2 Zn finger	676..695	CDD:275370
		C2H2 Zn finger	703..723	CDD:275368	5/19 (26%)
		zf-H2C2_2	715..740	CDD:290200	9/24 (38%)
		COG5048	727..>792	CDD:227381	25/64 (39%)
		C2H2 Zn finger	731..751	CDD:275368	6/19 (32%)
		zf-H2C2_2	743..767	CDD:290200	10/23 (43%)
		zf-C2H2	757..779	CDD:278523	8/21 (38%)
		C2H2 Zn finger	759..779	CDD:275368	7/19 (37%)
		zf-C2H2	785..807	CDD:278523	8/21 (38%)
		C2H2 Zn finger	787..807	CDD:275368	8/19 (42%)
		zf-H2C2_2	799..824	CDD:290200	11/24 (46%)
		C2H2 Zn finger	815..835	CDD:275368	5/21 (24%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000