DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment nom and ZNF341

DIOPT Version :9

Sequence 1:	NP_001262384.1	Gene:	nom / 41038	FlyBaseID:	FBgn0037617	Length:	370	Species:	Drosophila melanogaster
Sequence 2:	NP_001269862.1	Gene:	ZNF341 / 84905	HGNCID:	15992	Length:	854	Species:	Homo sapiens

Alignment Length:	152	Identity:	45/152 - (29%)
Similarity:	68/152 - (44%)	Gaps:	18/152 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   181 IHKCDTCGIIKNNKSSLVRHQFE---HNGIRPYPCKECPKTFLVASELKAHNLTHHTLEPPFACR 242
            ::||..| :.|.:....:.|..:   ||    :||..|.|.|.....|:.|..||.: ...|.|:
Human   539 VYKCVKC-VNKYSTPEALEHHLQTATHN----FPCPHCQKVFPCERYLRRHLPTHGS-GGRFKCQ 597

  Fly   243 YCDRRYFSVVGRKKHERVHTNERPFVCDQCGKAFTRTCILKAHMAVHQVVRKYSCDV-----CDR 302
            .|.:.:......|.|..:|:.|:|:.|..|..||.|...||.||.:|:..:||.|..     |.:
Human   598 VCKKFFRREHYLKLHAHIHSGEKPYKCSVCESAFNRKDKLKRHMLIHEPFKKYKCPFSTHTGCSK 662

  Fly   303 SFS----LKKHLATHFISNTHK 320
            .|:    ||.|:.:|.....||
Human   663 EFNRPDKLKAHILSHSGMKLHK 684

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
nom	NP_001262384.1	zf-AD	5..76	CDD:214871
		C2H2 Zn finger	184..204	CDD:275368	4/22 (18%)
		C2H2 Zn finger	212..261	CDD:275368	13/48 (27%)
		zf-H2C2_2	255..278	CDD:290200	9/22 (41%)
		C2H2 Zn finger	269..289	CDD:275368	9/19 (47%)
		zf-H2C2_2	282..305	CDD:290200	9/27 (33%)
		C2H2 Zn finger	297..313	CDD:275368	6/24 (25%)
ZNF341	NP_001269862.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	152..217
		COG5048	323..729	CDD:227381	45/152 (30%)
		C2H2 Zn finger	324..344	CDD:275368
		C2H2 Zn finger	352..372	CDD:275368
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	399..434
		C2H2 Zn finger	447..467	CDD:275368
		C2H2 Zn finger	475..497	CDD:275368
		C2H2 Zn finger	505..525	CDD:275368
		C2H2 Zn finger	542..562	CDD:275370	4/20 (20%)
		C2H2 Zn finger	568..588	CDD:275368	6/19 (32%)
		C2H2 Zn finger	596..616	CDD:275368	4/19 (21%)
		C2H2 Zn finger	624..644	CDD:275368	9/19 (47%)
		C2H2 Zn finger	652..677	CDD:275368	6/24 (25%)
		C2H2 Zn finger	685..705	CDD:275368	45/152 (30%)
		C2H2 Zn finger	713..730	CDD:275368
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	731..763
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165146331
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.930