DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nom and DOT5

DIOPT Version :9

Sequence 1:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_172787.1 Gene:DOT5 / 837889 AraportID:AT1G13290 Length:302 Species:Arabidopsis thaliana


Alignment Length:105 Identity:26/105 - (24%)
Similarity:42/105 - (40%) Gaps:29/105 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 GLESDHDLPNVQIHKC-DTCGIIKNNKS-----------SLVRHQFEHNGIRPYPC-KECPKTFL 220
            |.:|...:..:..:.| :.|   |||..           :|..|....:|.:|:.| |:|.|||.
plant   136 GTKSSSSILRLPCYCCAEGC---KNNIDHPRSKPLKDFRTLQTHYKRKHGAKPFRCRKKCEKTFA 197

  Fly   221 VASELKAHNLTHHTLEPPFACRYCDRRYFSVVGRK-KHER 259
            |..:.:.|.            :.|.:.:|.|.|.. ||:|
plant   198 VRGDWRTHE------------KNCGKLWFCVCGSDFKHKR 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nomNP_001262384.1 zf-AD 5..76 CDD:214871
C2H2 Zn finger 184..204 CDD:275368 7/31 (23%)
C2H2 Zn finger 212..261 CDD:275368 15/50 (30%)
zf-H2C2_2 255..278 CDD:290200 3/6 (50%)
C2H2 Zn finger 269..289 CDD:275368
zf-H2C2_2 282..305 CDD:290200
C2H2 Zn finger 297..313 CDD:275368
DOT5NP_172787.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.