DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nom and WIP3

DIOPT Version :9

Sequence 1:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_172306.1 Gene:WIP3 / 837349 AraportID:AT1G08290 Length:337 Species:Arabidopsis thaliana


Alignment Length:319 Identity:70/319 - (21%)
Similarity:109/319 - (34%) Gaps:106/319 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 QCILQQKKWVPLLQSDKVGASEEKKVEPNDPSTKKKTTKRRRGRPRMPLEIVDIVVTNE---SKA 129
            ||:       |||         .|.:|.|..::..|...:            |.|||.:   .|.
plant    73 QCL-------PLL---------NKLMENNSQASDIKEENK------------DDVVTLQIGFPKY 109

  Fly   130 SAGESVGGDE--FD---QPVEISNEPDATDSDVNLEEIDLPDEDGLESDHD-------LPN-VQI 181
            ..|.|..|.:  ||   :|::.....|.........::.. ||:.::||.:       :|: .||
plant   110 HRGSSEDGSDITFDHQKKPIKREIIEDGVVMMKKRRKMKF-DEEIIDSDVEVCGKRFWIPSPAQI 173

  Fly   182 H------KCDTCGIIKNNKSSLVRHQFEHNG------------IRP-----YPCKECPKTFLVAS 223
            |      .|..|....|..:::..|.:.|..            |:|     .||..|       :
plant   174 HVGPMQFACSICSKTFNRYNNMQMHMWGHGSEFRKGADSLKGTIQPAAILRLPCYCC-------A 231

  Fly   224 ELKAHNLTHHTLEPPFACRYCDRRYFSVVGRKKHERVHTNERPFVCDQCGKAFTRTCILKAHMAV 288
            |...:|:.|...:|....|.....|     ::||     ..:||.|.:||||..    :|.....
plant   232 EGCKNNINHPRSKPLKDFRTLQTHY-----KRKH-----GSKPFSCGKCGKALA----VKGDWRT 282

  Fly   289 HQ--VVRKYSCDVCDRSFSLKKHLATHFIS--NTHKRNAEAVTSSSEYMSML--SFESD 341
            |:  ..:.:.| .|...|..|:.|..|..|  :.|          |.:.|:|  .||.|
plant   283 HEKNCGKLWYC-TCGSDFKHKRSLKDHIRSFGSGH----------SPHPSLLFDGFEED 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nomNP_001262384.1 zf-AD 5..76 CDD:214871 2/7 (29%)
C2H2 Zn finger 184..204 CDD:275368 4/19 (21%)
C2H2 Zn finger 212..261 CDD:275368 10/48 (21%)
zf-H2C2_2 255..278 CDD:290200 9/22 (41%)
C2H2 Zn finger 269..289 CDD:275368 6/19 (32%)
zf-H2C2_2 282..305 CDD:290200 4/24 (17%)
C2H2 Zn finger 297..313 CDD:275368 5/15 (33%)
WIP3NP_172306.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.