DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nom and CG18764

DIOPT Version :9

Sequence 1:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster


Alignment Length:425 Identity:99/425 - (23%)
Similarity:153/425 - (36%) Gaps:115/425 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRVCGRSRLCPKAVELFKPGRQDILRRIQLITGILLQQIPNAPDMVCFCCQTDLQSAMIFRRQCI 70
            ||.||..........||....:.:|:.|.|:||..|...|..|..:|.||..||..|::||.:||
  Fly     5 CRTCGSIIYNKMPKNLFHIENEKMLQDINLVTGTTLHNDPELPSSICACCTLDLNQAILFRERCI 69

  Fly    71 LQQKKWVPLLQSDKVGASE-----EKKVEP----NDPSTKKKTTKRRRGRPRMPLEIVDIVVTNE 126
            |.||:.|...:|.:  |.|     |:...|    |||..                |:.:.:|.:.
  Fly    70 LTQKQLVHRRRSPE--AKEPAEDVEEMASPPDCLNDPFG----------------EVDEYIVESP 116

  Fly   127 SKASAGESVGGDEFDQPVEISN--------------EPDATD-----SDVNLEEIDLPDEDGLES 172
            .:....:|....:.|:...|.:              |.|:.|     |.|..|...:.::|....
  Fly   117 EEVLDHDSDAHHDLDEDNYIDSVEDVDALQDMAEVAEEDSQDVESLISSVQKELESICNDDSNSD 181

  Fly   173 DHDL---------------------PNVQIHK--------------------------------- 183
            ::|.                     ||..:.:                                 
  Fly   182 NNDYMEPQNGSYFNETINEYEVSSNPNTPLPESKSAAGRSTKPATTKPKRKKQYVTWKNMTEEQI 246

  Fly   184 -------------CDTCGIIKNNKSSLVRHQFEHNGIRPYPCKECPKTFLVASELKAHNLTHHTL 235
                         |:.||....::|:...|...|.|.:.:.|::|.|.|.....:..|....|..
  Fly   247 IERKRLQRKRECVCEQCGRQFTDQSNFKLHMLRHTGNKNFACQQCGKRFYTDHLMTLHQRIIHQG 311

  Fly   236 EPPFACRYCDRRYFSVVGRKKHERVHTNERPFVCDQCGKAFTRTCILKAHMAVHQVVRKYSCDVC 300
            |.|:.||:|.:.:.:...|..|||.|||.:|:.|..|.|.|......|.|..:|..||.::|.:|
  Fly   312 EKPYDCRFCTKSFHNSNTRLIHERTHTNAKPYSCHHCDKCFKSASGRKRHELIHTGVRAFACTIC 376

  Fly   301 DRSFSLKKHLATHFISNTHKRNAEAVTSSSEYMSM 335
            .:||....||..|..|..|  .|:|.|..:|.:.:
  Fly   377 KQSFQRNTHLKAHLRSKFH--TAKAKTIGAEVLQL 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nomNP_001262384.1 zf-AD 5..76 CDD:214871 27/69 (39%)
C2H2 Zn finger 184..204 CDD:275368 5/19 (26%)
C2H2 Zn finger 212..261 CDD:275368 15/48 (31%)
zf-H2C2_2 255..278 CDD:290200 11/22 (50%)
C2H2 Zn finger 269..289 CDD:275368 6/19 (32%)
zf-H2C2_2 282..305 CDD:290200 8/22 (36%)
C2H2 Zn finger 297..313 CDD:275368 6/15 (40%)
CG18764NP_652712.2 zf-AD 4..75 CDD:214871 27/69 (39%)
C2H2 Zn finger 260..280 CDD:275368 5/19 (26%)
zf-H2C2_2 272..297 CDD:290200 7/24 (29%)
C2H2 Zn finger 288..309 CDD:275368 5/20 (25%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)
C2H2 Zn finger 345..365 CDD:275368 6/19 (32%)
C2H2 Zn finger 373..391 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.