DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nom and CG1792

DIOPT Version :9

Sequence 1:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster


Alignment Length:402 Identity:108/402 - (26%)
Similarity:167/402 - (41%) Gaps:88/402 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRVCGRSRLCPKAVELFKPGRQDILRRIQLITGILLQQIP--NAPDMVCFCCQTDLQSAMIFRRQ 68
            ||.||....|.....||:.....:|.:|:::||:.|...|  ..|..:|..|:.|||:|:.||.:
  Fly     6 CRTCGLFIFCSTPSNLFEEPNSVMLHQIEVLTGLFLLGGPGNELPPFICSPCELDLQTAIAFRER 70

  Fly    69 CILQQKKWVPLLQSDKVGASE---------EKKVEPNDPSTKKKTTKRRRGRPRMPLEIVDIVVT 124
            .|..||   .|.:|..:|.:|         ||:::..:..|:              :|::|::..
  Fly    71 VIRTQK---TLQESPNLGNAELIESFAVGVEKEIQYAEEVTE--------------IEVIDLLPE 118

  Fly   125 NESKASAGESVGGDEFDQPVEISNEPDATDSDVNLEEIDLPDEDGLESDHDLPNV---------- 179
            ....         :|.::|.||..:.:.....|..:|..|     ..|....|.|          
  Fly   119 EHLL---------EETEEPYEICEQNEQPQVKVPAQEKKL-----RRSTKTTPTVFTSVKFADNS 169

  Fly   180 --------------------QIHK----CDTCGIIKNNKSSLVRHQFEHNGIRPYPCKECPKTFL 220
                                :..|    |:.||......|:...|...|.|::.:.|.:|.:.|.
  Fly   170 QATRTQWSRLTEDEVVALKRERRKRDCICEQCGRHFTCPSNFKLHLLRHTGVKSFACDQCSQQFY 234

  Fly   221 VASELKAHNLTH--HTLEPPFACRYCDRRYFSVVGRKKHERV-HTNERPFVCDQCGKAFTRTCIL 282
            .|:.|:.|...|  :.|   |.||||:..|.:..||.:|||: |||.:||.|.:|.|:|..:..|
  Fly   235 TATLLRRHQELHAGNAL---FQCRYCEATYSNASGRIQHERMRHTNVKPFTCKECNKSFAMSGKL 296

  Fly   283 KAHMAVHQVVRKYSCDVCDRSFSLKKHLATHFISNTHKRNAEAVTSSSEYMSMLSFESDETWSQG 347
            :.||..|..||.:.||.|..||..:.||.:|:.|..|     |.|||::.......|.|...|.|
  Fly   297 RTHMLSHTGVRAFHCDSCQVSFVRRSHLTSHYRSKGH-----AHTSSAQAALDNPVELDVKASNG 356

  Fly   348 TPLTTSIDEDLV 359
            .. |.:.||.|:
  Fly   357 MQ-TGAKDEALL 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nomNP_001262384.1 zf-AD 5..76 CDD:214871 25/71 (35%)
C2H2 Zn finger 184..204 CDD:275368 5/19 (26%)
C2H2 Zn finger 212..261 CDD:275368 19/51 (37%)
zf-H2C2_2 255..278 CDD:290200 12/23 (52%)
C2H2 Zn finger 269..289 CDD:275368 7/19 (37%)
zf-H2C2_2 282..305 CDD:290200 10/22 (45%)
C2H2 Zn finger 297..313 CDD:275368 7/15 (47%)
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 26/76 (34%)
C2H2 Zn finger 198..218 CDD:275368 5/19 (26%)
C2H2 Zn finger 226..243 CDD:275368 5/16 (31%)
C2H2 Zn finger 254..275 CDD:275368 10/20 (50%)
zf-C2H2 281..303 CDD:278523 8/21 (38%)
C2H2 Zn finger 283..303 CDD:275368 7/19 (37%)
zf-H2C2_2 296..320 CDD:290200 11/23 (48%)
C2H2 Zn finger 311..329 CDD:275368 8/17 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447756
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 1 1.100 - - P PTHR24388
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.