Sequence 1: | NP_001262384.1 | Gene: | nom / 41038 | FlyBaseID: | FBgn0037617 | Length: | 370 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_732827.1 | Gene: | CG31365 / 42736 | FlyBaseID: | FBgn0051365 | Length: | 639 | Species: | Drosophila melanogaster |
Alignment Length: | 586 | Identity: | 101/586 - (17%) |
---|---|---|---|
Similarity: | 167/586 - (28%) | Gaps: | 261/586 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 LINVCRVCGRSRLCPKAVELFKPGRQDILRRIQLITGILL--QQIPNAPDMVCFCCQTDLQSAMI 64
Fly 65 FRRQCILQQK---KWVPLL-------------------------------QSDKVGASEEKK--- 92
Fly 93 ---------------------------------VEPNDPSTKKKTTKRRRGRPR----------- 113
Fly 114 ------MPLEIVDIVVTNESKASAGESVGGDEFDQPVEIS------------------------- 147
Fly 148 ------------------NEPDATDSDVNLEEIDLPDEDGLESDHDLPNVQ------IHKCDTCG 188
Fly 189 IIKNNKSSLVRHQ-----FEH-NGIRPYPCKE--------------------------------- 214
Fly 215 ---------------------------------------------------------CPKTFLVA 222
Fly 223 SELKAHNLTH---------HTLEPPFACRYCDRRYFSVVGRKKHERVHTNERPFVCDQCGKAFTR 278
Fly 279 TCILKAHMAVHQVVRKYSCDVCDRSFSLKKHLATHF------ISNTHK-----RNAEAVTSSSEY 332
Fly 333 M 333 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
nom | NP_001262384.1 | zf-AD | 5..76 | CDD:214871 | 15/75 (20%) |
C2H2 Zn finger | 184..204 | CDD:275368 | 6/24 (25%) | ||
C2H2 Zn finger | 212..261 | CDD:275368 | 15/147 (10%) | ||
zf-H2C2_2 | 255..278 | CDD:290200 | 9/22 (41%) | ||
C2H2 Zn finger | 269..289 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 282..305 | CDD:290200 | 8/22 (36%) | ||
C2H2 Zn finger | 297..313 | CDD:275368 | 5/15 (33%) | ||
CG31365 | NP_732827.1 | zf-AD | 13..86 | CDD:214871 | 15/74 (20%) |
vATP-synt_E | 109..>244 | CDD:304907 | 19/135 (14%) | ||
RRF | <161..222 | CDD:294170 | 8/61 (13%) | ||
zf-C2H2_8 | 454..530 | CDD:292531 | 22/79 (28%) | ||
C2H2 Zn finger | 485..505 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 497..522 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 513..533 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 526..550 | CDD:290200 | 9/23 (39%) | ||
C2H2 Zn finger | 541..562 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 571..591 | CDD:275368 | 3/18 (17%) | ||
C2H2 Zn finger | 598..617 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 62 | 1.000 | Inparanoid score | I2531 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |