DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nom and CG4936

DIOPT Version :9

Sequence 1:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster


Alignment Length:501 Identity:111/501 - (22%)
Similarity:173/501 - (34%) Gaps:174/501 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VCRVCGRSRLCPKAVELFKPGRQDILRRIQLITGILLQQIPNAPDMVCFCCQTDLQSAMIFRRQC 69
            |||||.:....|.|........:|:...|:...|:.::|..:.||.:|..|...|:.|..||..|
  Fly    22 VCRVCLQQPKEPMASIFNDDSEKDLTHMIRECGGVPIKQFDHYPDKICEKCFKVLKMAFKFRETC 86

  Fly    70 ILQQKKWVPLLQ-----------SDKVGASEEKKVEPN-DPSTKKKTTKRRRGRPRMPL------ 116
               |:.:..|.|           .:|.|:....|:||: ||...::..:.......:.|      
  Fly    87 ---QRSYGHLRQFVGPVEVEQRPPEKKGSETATKLEPDVDPDEAEQEPEHDEEDEDVDLDESHYA 148

  Fly   117 ---------------EIVD-----------IVVTNESKASAG---------ESVGGD-------- 138
                           ||.|           :.|.||.....|         |:..||        
  Fly   149 EADDAAETQGGVFHDEIEDGILVELEKDRIVHVKNEQVEEDGIIEEVYDVYETYEGDLIPDQGYD 213

  Fly   139 ---------------------EFDQPVEISNEPDATDSDVN-LEEIDLPDED------------- 168
                                 |.||..|.::|.|| :.|:| .||..:|.:.             
  Fly   214 HEMADQALSELSAEIEYLDQVEHDQLTESAHEDDA-EVDLNSTEEEFVPSKSVRASIHARNATKR 277

  Fly   169 --------------------------------------------GLESDHDLPNVQI-------- 181
                                                        .::|:.|:...::        
  Fly   278 RVNPRRSATSTASVAVESSTSKTTDRGNPLKVRRGNSDSAGSKMSIKSEKDISIGEVLARKHSGI 342

  Fly   182 -----HK------------CDTCGIIKNNKSSLVRHQFEHNGIRPYPCKECPKTFLVASELKAHN 229
                 ||            ||.||.:..::|.|..|...|:|::|:.|:.|...|..|.:|..| 
  Fly   343 KTKGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGHCFAQAQQLARH- 406

  Fly   230 LTHHTLEPPFACRYCDRRYFSVVGRKKHERVHTNERPFVCDQCGKAFTRTCILKAHMAVHQVVRK 294
            :..||...|:.|.||...:..:..|.||.|:||||||:.||.|.|.||.|..||.|..:|...:.
  Fly   407 MNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFHKMIHTGEKP 471

  Fly   295 YSCDVCDRSFSLKKHLATHFISNTHKRNAEAVTSSSEYMSMLSFES 340
            :.||||.:.|.....|..|.:  .|:|..::...|  ...::|:::
  Fly   472 HVCDVCGKGFPQAYKLRNHRV--IHERRGQSARES--VAGLVSYDT 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nomNP_001262384.1 zf-AD 5..76 CDD:214871 21/70 (30%)
C2H2 Zn finger 184..204 CDD:275368 7/19 (37%)
C2H2 Zn finger 212..261 CDD:275368 16/48 (33%)
zf-H2C2_2 255..278 CDD:290200 14/22 (64%)
C2H2 Zn finger 269..289 CDD:275368 10/19 (53%)
zf-H2C2_2 282..305 CDD:290200 8/22 (36%)
C2H2 Zn finger 297..313 CDD:275368 6/15 (40%)
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 22/75 (29%)
C2H2 Zn finger 362..382 CDD:275368 7/19 (37%)
zf-H2C2_2 375..399 CDD:290200 8/23 (35%)
COG5048 386..>447 CDD:227381 23/61 (38%)
C2H2 Zn finger 390..410 CDD:275368 6/20 (30%)
zf-H2C2_2 403..426 CDD:290200 8/23 (35%)
C2H2 Zn finger 418..438 CDD:275368 7/19 (37%)
zf-H2C2_2 432..455 CDD:290200 14/22 (64%)
C2H2 Zn finger 446..466 CDD:275368 10/19 (53%)
zf-H2C2_2 459..481 CDD:290200 8/21 (38%)
C2H2 Zn finger 474..494 CDD:275368 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.