DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nom and CG4854

DIOPT Version :9

Sequence 1:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster


Alignment Length:338 Identity:97/338 - (28%)
Similarity:146/338 - (43%) Gaps:51/338 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRVCGRSRLCPKAVELFKPGRQDILRRIQLITGILLQQIPNAPDMVCFCCQTDLQSAMIFRRQCI 70
            ||:|    |.....|...|...|...:|:..||:.|.:.|:.|:.:|..|...|::|:..|..| 
  Fly    12 CRIC----LVQPKDESLMPTEPDFPDKIKRCTGVELSESPDWPNRICTSCALLLRAALKLRSLC- 71

  Fly    71 LQQKKWVPLLQSDKVGASEEKKVEPN------DPSTKKKTTKRRRGRPRMPLEIVDIVVTNESKA 129
                      |..:....|:|..|.|      :..|||||..|...:             ||:..
  Fly    72 ----------QQTEKDLKEQKLQEINIEIVHDEQETKKKTESRDLSK-------------NEATG 113

  Fly   130 SAGESVGG--DEFDQPVEISNEPDATDSD--VNLE-EIDLPDEDGLE--------SDHDLPNVQI 181
            |..|....  |.:|..:| |:|..|..:|  |::| .|..|:|....        .|.|......
  Fly   114 SDSELEYEYLDSYDVTLE-SSEDVACSADELVSIEPAISAPEESVYSLSPKPVTFEDEDSGQAAS 177

  Fly   182 HKCDTCGIIKNNKSSLVRHQFEHNGIRPYPCKECPKTFLVASELKAHNLTHHTLEPPFACRYCDR 246
            ..|:.|..:.:.:..|..|...|:..:|:.|:.|.|.|....:|..| :..||...|:.|.|||.
  Fly   178 FTCNICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARH-MNTHTGNRPYKCDYCDS 241

  Fly   247 RYFSVVGRKKHERVHTNERPFVCDQCGKAFTRTCILKAHMAVHQVVRKYSCDVCDRSFSLKKHLA 311
            |:.....|.||:|:||||||:.|:.|.::|..:.:|:.|:..|...|.:||..|.:|||...|..
  Fly   242 RFADPSTRIKHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQLHHKN 306

  Fly   312 THFISNTHKRNAE 324
            :|  ..:|||..|
  Fly   307 SH--EKSHKRTKE 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nomNP_001262384.1 zf-AD 5..76 CDD:214871 19/69 (28%)
C2H2 Zn finger 184..204 CDD:275368 4/19 (21%)
C2H2 Zn finger 212..261 CDD:275368 18/48 (38%)
zf-H2C2_2 255..278 CDD:290200 12/22 (55%)
C2H2 Zn finger 269..289 CDD:275368 5/19 (26%)
zf-H2C2_2 282..305 CDD:290200 8/22 (36%)
C2H2 Zn finger 297..313 CDD:275368 6/15 (40%)
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071 14/48 (29%)
C2H2 Zn finger 180..200 CDD:275368 4/19 (21%)
zf-H2C2_2 193..217 CDD:290200 8/23 (35%)
COG5048 201..>258 CDD:227381 20/57 (35%)
C2H2 Zn finger 208..228 CDD:275368 6/20 (30%)
zf-H2C2_2 221..244 CDD:290200 10/23 (43%)
C2H2 Zn finger 236..256 CDD:275368 9/19 (47%)
zf-H2C2_2 251..273 CDD:290200 12/21 (57%)
C2H2 Zn finger 264..284 CDD:275368 5/19 (26%)
zf-H2C2_2 277..301 CDD:290200 9/23 (39%)
C2H2 Zn finger 292..312 CDD:275368 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.