DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nom and Odj

DIOPT Version :9

Sequence 1:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_650661.1 Gene:Odj / 42145 FlyBaseID:FBgn0038551 Length:430 Species:Drosophila melanogaster


Alignment Length:420 Identity:95/420 - (22%)
Similarity:161/420 - (38%) Gaps:94/420 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRVCGRSRLCPKAVELFKPGRQDILRRIQLITG--ILLQQIPNAPDMVCFCCQTDLQSAMIFRRQ 68
            ||:||.....|....:|:.....|...|:.|||  |:|:.:  .|..:|.||..||..|:.||::
  Fly     5 CRICGERIFTPHPKNIFEKRNHRIRMAIEQITGLEIVLENM--LPQHICACCLLDLTQAVAFRQR 67

  Fly    69 CI-----LQQKKWVPLLQSDKVGASEE--KKVEP--NDPSTKKKTTKRRRGRPRMPLEIVDIVVT 124
            |:     |.|:      .|.|.|.:.:  .:|.|  :||..|:              |::|..|.
  Fly    68 CLETHANLHQR------ISSKAGVASKGSPEVSPVLSDPLLKR--------------EVLDDTVD 112

  Fly   125 NESKASAGESVGGD-----------EFDQP-----------VEISNEPDATDSDVNLEEIDLPDE 167
            .|...   |.:..|           |.::|           :|..|.|:.....|.::.:.:|..
  Fly   113 TEDDK---ELLDDDKDLMDDDKDFLEDEKPILRYPPAKKIRIEDQNFPNRQSPRVRVKRLRVPVV 174

  Fly   168 DGLESDHDLPNVQIHK------------------CDTCGIIKNNKSSLVRHQFEHNGIRPYPCKE 214
            :..:|....|...:.|                  ||.||...|:.|::..|:..|.. ..:.|.|
  Fly   175 EKADSPPPPPREHVRKPRKRRPKPKVDRSIKRYVCDQCGWSFNDHSNMKDHKLRHFE-EKFSCDE 238

  Fly   215 CPKTFLVASELKAHNLTHHTLEPPFACRYCDRRYFSVVGRKKHER-VHTNERPFVCDQCGKAFTR 278
            |.:.|.....|:.|...||..|.|:.|::|...:.:...|.:||| :|.||....|..|||.|..
  Fly   239 CGRKFYTMPLLRLHIRVHHKGEKPYVCKFCGMGFANSPSRCRHERQMHANELVHPCKICGKRFNS 303

  Fly   279 TCILKAHMAVHQVVRK--YSCDVCDRSFSLKKHLATHFISNTHKRNAEAVTSSSE---------- 331
            ......|...|:..:.  :.|..|::.|...:.|..|:.:..|::....:.:..:          
  Fly   304 EKGRLKHEEGHKSDQPDVHICLTCNKEFKEAQFLHRHYSTKYHRKRVNLLVNGPKEEFQSEVDPA 368

  Fly   332 ----YMSMLSFESDETWSQGTPLTTSIDED 357
                ||.....|.::..::...:..:|||:
  Fly   369 EFPGYMEEGQAEMEDNQAELDVMLDNIDEE 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nomNP_001262384.1 zf-AD 5..76 CDD:214871 25/76 (33%)
C2H2 Zn finger 184..204 CDD:275368 7/19 (37%)
C2H2 Zn finger 212..261 CDD:275368 16/49 (33%)
zf-H2C2_2 255..278 CDD:290200 11/23 (48%)
C2H2 Zn finger 269..289 CDD:275368 6/19 (32%)
zf-H2C2_2 282..305 CDD:290200 4/24 (17%)
C2H2 Zn finger 297..313 CDD:275368 4/15 (27%)
OdjNP_650661.1 zf-AD 5..77 CDD:214871 24/73 (33%)
COG5048 <202..343 CDD:227381 39/141 (28%)
C2H2 Zn finger 209..229 CDD:275368 7/19 (37%)
C2H2 Zn finger 236..256 CDD:275368 6/19 (32%)
zf-H2C2_2 249..274 CDD:290200 8/24 (33%)
C2H2 Zn finger 265..283 CDD:275368 4/17 (24%)
C2H2 Zn finger 298..314 CDD:275368 4/15 (27%)
zf-C2H2_jaz 322..347 CDD:288983 5/24 (21%)
C2H2 Zn finger 324..343 CDD:275368 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.