DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nom and CG6654

DIOPT Version :9

Sequence 1:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster


Alignment Length:217 Identity:63/217 - (29%)
Similarity:91/217 - (41%) Gaps:59/217 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 DHDLPNVQIHK------CDTCGIIKNNKSSLVRHQFEHNGIRPYPCKECPKTFLVASELKAHNLT 231
            ||    ::||.      |:.||......::|.:|:..|:..:.:.|:.||.:|:..:||.:|..|
  Fly   429 DH----MRIHTGEKPFVCNICGKSFTQNANLRQHKLRHSETKSFKCELCPHSFVTKAELTSHART 489

  Fly   232 H---------------------------HTLEPPFACRYCDRRYFSVVGRKKHERVHTNERPFVC 269
            |                           ||.|.|:||..|..|:.::...|.|.|.||.|||:||
  Fly   490 HTGDKPFECEVCLARFTTSCSLAKHKRKHTGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVC 554

  Fly   270 DQCGKAFTRTCILKAHMAVHQVVRKYSCDVCDRSF----SLKKHLATH-----------FISNTH 319
            ..|.|.||:....:.|...||..|.|.|.||:..|    .::.|||.|           |:||  
  Fly   555 PFCSKTFTQRGDCQMHQRTHQGERIYICPVCNEEFKSMPEMRSHLAGHEQHDKRLVHFTFLSN-- 617

  Fly   320 KRNA-----EAVTSSSEYMSML 336
            |.|.     |.:...:|...||
  Fly   618 KENGSGALEEELNEMTESALML 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nomNP_001262384.1 zf-AD 5..76 CDD:214871
C2H2 Zn finger 184..204 CDD:275368 5/19 (26%)
C2H2 Zn finger 212..261 CDD:275368 20/75 (27%)
zf-H2C2_2 255..278 CDD:290200 13/22 (59%)
C2H2 Zn finger 269..289 CDD:275368 6/19 (32%)
zf-H2C2_2 282..305 CDD:290200 9/26 (35%)
C2H2 Zn finger 297..313 CDD:275368 7/19 (37%)
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368
COG5048 <357..570 CDD:227381 41/144 (28%)
C2H2 Zn finger 360..380 CDD:275368
C2H2 Zn finger 385..406 CDD:275370
C2H2 Zn finger 414..434 CDD:275368 2/8 (25%)
zf-H2C2_2 427..451 CDD:290200 7/25 (28%)
C2H2 Zn finger 442..490 CDD:275368 13/47 (28%)
C2H2 Zn finger 470..487 CDD:275368 6/16 (38%)
zf-H2C2_2 482..507 CDD:290200 5/24 (21%)
C2H2 Zn finger 498..518 CDD:275368 0/19 (0%)
zf-H2C2_2 510..534 CDD:290200 8/23 (35%)
C2H2 Zn finger 526..546 CDD:275368 6/19 (32%)
zf-H2C2_2 539..563 CDD:290200 13/23 (57%)
C2H2 Zn finger 554..574 CDD:275368 6/19 (32%)
C2H2 Zn finger 582..602 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.