DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nom and CG6808

DIOPT Version :9

Sequence 1:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001247055.1 Gene:CG6808 / 41394 FlyBaseID:FBgn0037921 Length:375 Species:Drosophila melanogaster


Alignment Length:380 Identity:96/380 - (25%)
Similarity:150/380 - (39%) Gaps:60/380 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NVCRVCGRSRLCPKAVELFKPGRQDILRRIQLITGILLQQIPNAPDMVCFCCQTDLQSAMIFRRQ 68
            ::||.|.:.........||:.....:|..   ..|..::.....||.:|..|...|:....|...
  Fly     8 SMCRTCRKKGTQSTLQSLFESNAHKLLIS---YAGTSVKPDDGLPDQICTVCLMQLEEVDRFLSA 69

  Fly    69 CILQQKKWVPLLQSDKVGASEEKKVEPNDPSTKKKTTKRRRGRPRMPLEIVDIVVTNESKASAGE 133
            |.........|::.....||..:.:|..|...:||..:::....|:   |.:..:..:::.:|.|
  Fly    70 CKQSDAHLRSLVRQTLSSASAFETLEDKDQLEQKKRARKQNISGRL---IEENPINFKTQENALE 131

  Fly   134 SVGGDE------------FDQPVEISNEPDATDSDVNLEEIDLPDE------------------D 168
            :...||            ||..|...||.|....|..:.::||..|                  |
  Fly   132 TTKDDEILPINKFSSDFVFDLNVNAENEKDIHQEDYTISDMDLDREISDQNYSETYSQESSAATD 196

  Fly   169 GL-ESDHDLPNVQ----------------IHKCDTCGIIKNNKSSLVRHQFEHNGIRPYPCKECP 216
            .: |:..|..|::                .::|..|.......|.|..|...|...:.:.|:.|.
  Fly   197 SIQETSEDYHNLEPSADYVIDLGVACEPDKYRCKICSNTYRCLSQLNAHSQVHRKEKDHQCEVCQ 261

  Fly   217 KTFLVASELKAHNLTHHTLEPPFACRYCDRRYFSVVGRKKHERVHTNERPFVCDQCGKAFTRTCI 281
            |||..|..||.|..| ||.|.|:.|.||.||:......:||||:||||||:.|:.|||.|:.:..
  Fly   262 KTFRAACNLKTHMRT-HTGEKPYQCCYCSRRFADNSTHRKHERLHTNERPYACNICGKTFSLSSS 325

  Fly   282 LKAHMAVHQVVRKYSCDVCDRSFSLKKHLATHFISNTHKRNAEAVTSSSEYMSML 336
            ..||..:|...:.:.|.:|.:.|.||..|..|..|..|:..|:      ||..::
  Fly   326 RNAHYYLHSSEKSHKCLMCKKEFRLKHQLTAHEKSLAHRLIAK------EYSDVV 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nomNP_001262384.1 zf-AD 5..76 CDD:214871 14/70 (20%)
C2H2 Zn finger 184..204 CDD:275368 5/19 (26%)
C2H2 Zn finger 212..261 CDD:275368 23/48 (48%)
zf-H2C2_2 255..278 CDD:290200 15/22 (68%)
C2H2 Zn finger 269..289 CDD:275368 7/19 (37%)
zf-H2C2_2 282..305 CDD:290200 5/22 (23%)
C2H2 Zn finger 297..313 CDD:275368 6/15 (40%)
CG6808NP_001247055.1 zf-AD 9..79 CDD:214871 14/72 (19%)
C2H2 Zn finger 229..249 CDD:275368 5/19 (26%)
zf-C2H2 255..277 CDD:278523 10/22 (45%)
C2H2 Zn finger 257..277 CDD:275368 10/20 (50%)
zf-H2C2_2 269..293 CDD:290200 13/24 (54%)
C2H2 Zn finger 285..305 CDD:275368 9/19 (47%)
zf-H2C2_2 299..321 CDD:290200 14/21 (67%)
C2H2 Zn finger 313..333 CDD:275368 7/19 (37%)
C2H2 Zn finger 341..359 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.