DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nom and CG31388

DIOPT Version :9

Sequence 1:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster


Alignment Length:442 Identity:111/442 - (25%)
Similarity:170/442 - (38%) Gaps:128/442 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VCRVCGRSRLCPKAV--ELFKPGRQDILRRIQLITGILLQQIPNAPDMVCFCCQTDLQSAMIFRR 67
            :||.|  ||:...||  .||.|....:||:|:.:|.:.|::....|..:|..||.|||.|:.|||
  Fly     4 ICRTC--SRMADPAVAKNLFDPSSSSVLRQIETLTNLQLKEDGKLPRFMCQDCQHDLQIAIDFRR 66

  Fly    68 QCILQQ---------------------KKWV-----------PLLQ-SDKVGASEEKKVEPNDPS 99
            .||..|                     ::|:           |:|| :|::....:.  ||.|.:
  Fly    67 VCIEAQELLELQLRQVEKEEEAFESLAEQWLDDCPDELSNLSPVLQLNDRMDFIFDP--EPQDKN 129

  Fly   100 TKK----KTTKRRRGRPRMPLEIVDIVVTNES--KASAGESVGGDEFDQPVEISNEPDATDSD-- 156
            |.:    |||....     .:.....|.:.:|  :.|....:..:.||..:...:||::...|  
  Fly   130 TDELASIKTTTTTE-----YMNAYQSVASPQSSPELSTDSQLSNEHFDMGLSPESEPESEAIDNR 189

  Fly   157 ---------------VNLEEIDL---------PD--------EDGLES----------------- 172
                           .|::|:.|         ||        ::|..|                 
  Fly   190 DTSSSHTCSKCGLEFENVDELKLHKYHLHDIPPDTKFVCDHCDEGFRSAAALTRHCNMINLPLTH 254

  Fly   173 ----------DHDL----------PNVQIHKCDTCGIIKNNKSSLVRHQFEHNGIRPYPCKECPK 217
                      :|.|          |....|.|..||.......:|..|...|.|.|.:.|.:|..
  Fly   255 SCTKCKSQFHNHILLETHKQRCLRPPASQHVCHICGKHLTTAFNLKNHLVRHAGTRRHKCDQCSA 319

  Fly   218 TFLVASELKAHNLTHHTLEPPFACRY-CDRRYFSVVGRKKHERVH--TNERPFVCDQCGKAFTRT 279
            :|..|:||.:|..| ||.|.|:.||| |.:.:.....|..|||||  .::|.:.|:.|.|::...
  Fly   320 SFYTAAELCSHQKT-HTTERPYICRYNCGKTFRFCSARSMHERVHMDASKRIYQCEYCPKSYVTP 383

  Fly   280 CILKAHMAVHQVVRKYSCDVCDRSFSLKKHLATHFISNTHK---RNAEAVTS 328
            ...:.|...|.:.|.:.|::|..||...||..:|..||.||   ..|:|..|
  Fly   384 SECRTHQKYHNLTRDHGCEICRISFKTAKHYRSHLKSNAHKTLEARAKAAAS 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nomNP_001262384.1 zf-AD 5..76 CDD:214871 29/93 (31%)
C2H2 Zn finger 184..204 CDD:275368 5/19 (26%)
C2H2 Zn finger 212..261 CDD:275368 20/49 (41%)
zf-H2C2_2 255..278 CDD:290200 9/24 (38%)
C2H2 Zn finger 269..289 CDD:275368 4/19 (21%)
zf-H2C2_2 282..305 CDD:290200 6/22 (27%)
C2H2 Zn finger 297..313 CDD:275368 6/15 (40%)
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 29/73 (40%)
C2H2 Zn finger 228..254 CDD:275368 2/25 (8%)
C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..334 CDD:275368 8/20 (40%)
C2H2 Zn finger 342..363 CDD:275368 8/20 (40%)
C2H2 Zn finger 373..393 CDD:275368 4/19 (21%)
C2H2 Zn finger 401..419 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.