DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nom and CG14667

DIOPT Version :9

Sequence 1:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster


Alignment Length:377 Identity:92/377 - (24%)
Similarity:154/377 - (40%) Gaps:87/377 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LINVCRVCG-------RSRLCPKAVELFKPGRQDILRRIQLITGILLQQIPNAPDMVCFCCQTDL 59
            |.:|||:|.       |.|      .:|...|...|.:::||||:.|.:....|::||..|.::|
  Fly     3 LADVCRICANKIMGHQRDR------NIFIHMRGKYLGQLKLITGVELTRNQGLPEIVCERCFSEL 61

  Fly    60 QSAMIFRRQCILQQKKWVPLLQ--SDKVGASEEKKVEPNDPSTKKKTTKRRRGRPRMPLEIVDIV 122
            ..|..||.:||..||..:.:::  ||:.....|...||.|.                  :::|. 
  Fly    62 DLATKFRERCIFSQKYLLDIIKKTSDQSTVHVELSSEPLDE------------------QLIDA- 107

  Fly   123 VTNESKASAGESVGGDEFDQPVEISNEPD-------ATDSDVNLEEIDLPDEDG----------- 169
                              || :|...:.|       ..:...:||||:|.|:..           
  Fly   108 ------------------DQ-LETHYDDDQYVCYQGTKEEHQDLEEIELDDDPSAAVIAAAEAAA 153

  Fly   170 -LESDHDLPNVQIHK----------CDTCGIIKNNKSSLVRHQFEHNGIRP----YPCKECPKTF 219
             .....||...::.:          ||.||.:.::......|...|...|.    :||.|||:||
  Fly   154 EAAQQEDLQEQEMERAAKRRSNFFICDECGTLFHDAFLYTEHLNGHQNRRDMNQFFPCPECPQTF 218

  Fly   220 LVASELKAHNLTHHTLEPPFACRYCDRRYFSVVGRKKHERVHTNERPFVCDQCGKAFTRTCILKA 284
            ...:.||.|....|.:...|.|..|...:.|:..:.:|::.|.||||:.|.:||..|:....|:.
  Fly   219 NKKALLKQHRTQVHLINRRFQCTICHEAFASLGAKLRHDKAHKNERPYPCLECGMIFSSVSELQN 283

  Fly   285 HMAVH-QVVRKYSCDVCDRSFSLKKHLATHFISNTHKRNAEAVTSSSEYMSM 335
            |.:.| :.:||:.|:.|:..|..::.|..|..:..|||.|:.:....:::.:
  Fly   284 HFSTHSKQIRKFRCEPCNMDFITRRGLVAHTKTAPHKRLAKYMQDEFDFIEL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nomNP_001262384.1 zf-AD 5..76 CDD:214871 26/77 (34%)
C2H2 Zn finger 184..204 CDD:275368 5/19 (26%)
C2H2 Zn finger 212..261 CDD:275368 15/48 (31%)
zf-H2C2_2 255..278 CDD:290200 10/22 (45%)
C2H2 Zn finger 269..289 CDD:275368 6/19 (32%)
zf-H2C2_2 282..305 CDD:290200 7/23 (30%)
C2H2 Zn finger 297..313 CDD:275368 4/15 (27%)
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 26/79 (33%)
C2H2 Zn finger 179..199 CDD:275368 5/19 (26%)
C2H2 Zn finger 211..232 CDD:275368 9/20 (45%)
C2H2 Zn finger 240..260 CDD:275368 4/19 (21%)
zf-C2H2_8 243..313 CDD:292531 21/69 (30%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
C2H2 Zn finger 297..316 CDD:275368 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.