DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nom and CG17359

DIOPT Version :9

Sequence 1:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster


Alignment Length:336 Identity:80/336 - (23%)
Similarity:124/336 - (36%) Gaps:71/336 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VCRVCGRSRLC-------PKA----VELFKPGRQDILRRIQLITGILLQQIPNAPDMVCFCCQTD 58
            :||||.....|       |.|    |:..:|....:||.   .:|..:.:....|..:|..|...
  Fly     6 MCRVCRDESDCLLDIYTEPYASSNRVQEQEPVLATMLRE---CSGCSVHKEDGMPQFICVECAEA 67

  Fly    59 LQSAMIFRRQC----------ILQQKKWVPLLQSDKVGASEEKKVEPNDPSTKKKTTKRRRGRPR 113
            :::|...||||          .|..|:...:.....:|    ..:||..|.:..:..|.......
  Fly    68 VRNAYRLRRQCRKSHQYFEQLRLMMKELDDIEYCLNIG----DNIEPQMPVSVMEAGKTPETSEP 128

  Fly   114 MPLEIVDI------------------------------VVTNESKASAGESVGGDEFDQPVEISN 148
            :.:|:|.:                              ...|:||..|......|.:....|:.:
  Fly   129 LLVELVQVKYMPPEPKPISSPLPDNNEHKLAQSYSPAKTPHNKSKRRARSYSDNDSWSPDSELEH 193

  Fly   149 EPDATDSDVNLEEIDLPDEDGLESDHDLPNVQIHKCDTCGIIKNNKSSLVRHQFEHNGIRPYPCK 213
            |.|  |...|..:...|..        :|..  ::|..|......|.:|..|...|.|.|||.|.
  Fly   194 EDD--DKIWNASKRGKPKR--------VPGP--YRCKLCTQSFTQKQNLEIHMRIHTGERPYKCS 246

  Fly   214 ECPKTFLVASELKAHNLTHHTLEPPFACRYCDRRYFSVVGRKKHERVHTNERPFVCDQCGKAFTR 278
            .||::|.....|::|... ||.|.||.|..|.:|:..|...:.|.|.||.|:||.|.:|.::|.:
  Fly   247 LCPRSFAQKGNLQSHTRC-HTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQ 310

  Fly   279 TCILKAHMAVH 289
            ...|:.||:.|
  Fly   311 LNGLQKHMSAH 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nomNP_001262384.1 zf-AD 5..76 CDD:214871 22/91 (24%)
C2H2 Zn finger 184..204 CDD:275368 5/19 (26%)
C2H2 Zn finger 212..261 CDD:275368 17/48 (35%)
zf-H2C2_2 255..278 CDD:290200 10/22 (45%)
C2H2 Zn finger 269..289 CDD:275368 6/19 (32%)
zf-H2C2_2 282..305 CDD:290200 4/8 (50%)
C2H2 Zn finger 297..313 CDD:275368
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 20/84 (24%)
zf-C2H2 215..237 CDD:278523 5/21 (24%)
C2H2 Zn finger 217..237 CDD:275368 5/19 (26%)
zf-H2C2_2 229..254 CDD:290200 11/24 (46%)
C2H2 Zn finger 245..265 CDD:275368 6/20 (30%)
zf-H2C2_2 257..282 CDD:290200 10/25 (40%)
C2H2 Zn finger 273..293 CDD:275368 6/19 (32%)
zf-H2C2_2 286..310 CDD:290200 10/23 (43%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.