DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nom and CG11906

DIOPT Version :9

Sequence 1:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_611402.2 Gene:CG11906 / 37209 FlyBaseID:FBgn0034425 Length:634 Species:Drosophila melanogaster


Alignment Length:348 Identity:62/348 - (17%)
Similarity:120/348 - (34%) Gaps:93/348 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRVCGRSRLCPKAVELFKPGRQDIL-RRIQLITGILLQQIPNAPDMVCF-C-CQTDLQSAMIFRR 67
            |.|||.:    ||..|.......:: ||:.....|....|.:....:|. | |:.::.|.:   .
  Fly    46 CTVCGAA----KASALLDLRSNHVMQRRLSRDWKIHADVIRSTLKAICVECVCKLNMHSEV---T 103

  Fly    68 QCILQQKKWVPLLQSDKVGASEEKKVEPNDPSTKKKTTKRRRGRPRMPLEI-VDIVVTNESKASA 131
            :.::|:      :|..:....|..||      |...|:..:...|....|: ..::.:.|..|.:
  Fly   104 RSLMQR------MQRLQRSGGETTKV------TTTTTSPSQHSPPIADAEVSTTLIESQEEVAHS 156

  Fly   132 GESVGGDEFDQPVEI-----SNEPDATDSDVNLEEIDLPDEDGLESDHDLPNVQIHKCDTCGIIK 191
            |:||........:|:     ...|.|.::          :|...|.......::.|:|......:
  Fly   157 GQSVRSRSSCSVLEVYLAQQPYSPSAKET----------EEKHAEGWKWRTRLECHECGRAYFRR 211

  Fly   192 NNKSSLVRHQFEHNGIRPYP----CK---------ECPKTFLVASELKAHNLTHHTLEPPFACRY 243
            :..:..:|...:....:|.|    |:         |.|...:.:|.:             :.||:
  Fly   212 DYYAQHLRRCSKTRRKQPRPSRVKCRVLNEASYDEEAPSRAIRSSRI-------------YYCRH 263

  Fly   244 CDRRYFSVVGRKKHERVHTNERPFVCDQCGKAFTRTCILKAHMAVHQVVRKYSCDVCDRSFSLKK 308
            ||..:.:::.:::|||:.                           ||  ::|.||:|:.....|.
  Fly   264 CDAEFETLISKRQHERMK---------------------------HQ--QRYPCDLCEAQLDTKY 299

  Fly   309 HLATHFISNTHKRNAEAVTSSSE 331
            ....|......|:.|.|:....|
  Fly   300 EWEMHHTICQAKQEALAIVEQQE 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nomNP_001262384.1 zf-AD 5..76 CDD:214871 16/72 (22%)
C2H2 Zn finger 184..204 CDD:275368 2/19 (11%)
C2H2 Zn finger 212..261 CDD:275368 11/57 (19%)
zf-H2C2_2 255..278 CDD:290200 3/22 (14%)
C2H2 Zn finger 269..289 CDD:275368 0/19 (0%)
zf-H2C2_2 282..305 CDD:290200 6/22 (27%)
C2H2 Zn finger 297..313 CDD:275368 4/15 (27%)
CG11906NP_611402.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.