Sequence 1: | NP_001262384.1 | Gene: | nom / 41038 | FlyBaseID: | FBgn0037617 | Length: | 370 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097306.2 | Gene: | cg / 36571 | FlyBaseID: | FBgn0000289 | Length: | 837 | Species: | Drosophila melanogaster |
Alignment Length: | 196 | Identity: | 62/196 - (31%) |
---|---|---|---|
Similarity: | 89/196 - (45%) | Gaps: | 20/196 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 132 GESVGGDEFDQPVEISNEPDATDSDVNLE--EIDLPDEDGL-------ESDHDLPNVQIHKCDTC 187
Fly 188 GIIKNNKSSLVRHQFE-----HNGIRPYPCKECPKTFLVASELKAHNLTHHTLEPPFACRYCDRR 247
Fly 248 YFSVVGRKKHERVHTNERPFVCDQCGKAFTRTCILKAHMAVHQVVRKYSCDVCDRSFSLKKHLAT 312
Fly 313 H 313 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
nom | NP_001262384.1 | zf-AD | 5..76 | CDD:214871 | |
C2H2 Zn finger | 184..204 | CDD:275368 | 8/24 (33%) | ||
C2H2 Zn finger | 212..261 | CDD:275368 | 15/48 (31%) | ||
zf-H2C2_2 | 255..278 | CDD:290200 | 14/22 (64%) | ||
C2H2 Zn finger | 269..289 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 282..305 | CDD:290200 | 8/22 (36%) | ||
C2H2 Zn finger | 297..313 | CDD:275368 | 6/15 (40%) | ||
cg | NP_001097306.2 | COG5048 | 287..>371 | CDD:227381 | 28/89 (31%) |
C2H2 Zn finger | 294..314 | CDD:275368 | 8/24 (33%) | ||
zf-H2C2_2 | 306..331 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 322..342 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 350..370 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 362..385 | CDD:290200 | 12/22 (55%) | ||
C2H2 Zn finger | 378..398 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 390..415 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 406..426 | CDD:275368 | 7/17 (41%) | ||
SIR2 | <425..>465 | CDD:294129 | |||
C2H2 Zn finger | 434..454 | CDD:275368 | |||
C2H2 Zn finger | 461..482 | CDD:275368 | |||
C2H2 Zn finger | 490..509 | CDD:275368 | |||
lambda-1 | 491..>603 | CDD:212564 | |||
C2H2 Zn finger | 575..595 | CDD:275368 | |||
C2H2 Zn finger | 720..740 | CDD:275368 | |||
C2H2 Zn finger | 752..771 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24388 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |