DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nom and CG17328

DIOPT Version :9

Sequence 1:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster


Alignment Length:378 Identity:85/378 - (22%)
Similarity:142/378 - (37%) Gaps:102/378 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VCRVCGRSRLCPKAVELFKPGRQDILRRIQLITGILLQQ--------IPNAPDMVCFCCQTDLQS 61
            :||||         :|...|..........::..::|.|        ....|.::|..|...|..
  Fly     8 ICRVC---------LEELHPVTSIYSTDFAMMPSVMLMQCAKIRVFKTDGLPSVICNNCIYRLGV 63

  Fly    62 AMIFRRQC---ILQQKKWVPLLQSDKVGASE-----EKKVEPNDPSTKK-----KTTKRRRGRPR 113
            |..|:::|   .|:.::::.:|:|.:..|:.     ||.:.|...|.::     |.:|||....|
  Fly    64 AFHFKQECENSDLRLRQYLGILESWRQDAATNTDFVEKPLLPQRDSDEEEPVDAKVSKRRSRYQR 128

  Fly   114 MPLEIVDIVVTNESKASAGESVGGDEFDQPVEISNEPDATDSDVNLEEIDLPDEDGLESDHDLPN 178
            .|                                                 |:|........:|.
  Fly   129 KP-------------------------------------------------PEEHKKRGPKPVPK 144

  Fly   179 VQIHKCDTCGIIKNNK--SSLVRHQFEHNGIRPYPCKECPKTFLVASELKAHNLTHHTLEPPFAC 241
            :. |.|..|.  |:.|  :.|.:|...|.|.:||.|..|.:.|.....||.|..| ||.:.||.|
  Fly   145 MP-HTCYECH--KSFKCIAQLTQHIRTHTGEKPYQCSFCIQRFAQKYNLKVHERT-HTGDKPFQC 205

  Fly   242 RYCDRRYFSVVGRKKHERVHTNERPFVCDQCGKAFTRTCILKAHMAVHQVVRKYSCDVCDRSFSL 306
            ..|.:::.::...:.|:::|...|..||..|.|.|.....|..||..|..::.:.||||.::||.
  Fly   206 EICSKQFSALGNFQAHQKIHLGVRDQVCSLCQKGFYTAGDLSKHMITHTGIKNHHCDVCGKAFSR 270

  Fly   307 KKHLATHFISNTHKRNAEAVTSSSEYMSMLSFESDETWSQGTPLTTSIDEDLV 359
            ::.:      .|||.....:.||:.: .::..:.||          :||.|.|
  Fly   271 RRDM------RTHKLKLHPLESSTNH-DIVDDDDDE----------AIDTDPV 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nomNP_001262384.1 zf-AD 5..76 CDD:214871 16/81 (20%)
C2H2 Zn finger 184..204 CDD:275368 6/21 (29%)
C2H2 Zn finger 212..261 CDD:275368 14/48 (29%)
zf-H2C2_2 255..278 CDD:290200 8/22 (36%)
C2H2 Zn finger 269..289 CDD:275368 7/19 (37%)
zf-H2C2_2 282..305 CDD:290200 8/22 (36%)
C2H2 Zn finger 297..313 CDD:275368 6/15 (40%)
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 16/80 (20%)
COG5048 146..>211 CDD:227381 24/68 (35%)
C2H2 Zn finger 149..169 CDD:275368 6/21 (29%)
C2H2 Zn finger 177..197 CDD:275368 7/20 (35%)
zf-H2C2_2 189..213 CDD:404364 10/24 (42%)
C2H2 Zn finger 205..225 CDD:275368 3/19 (16%)
C2H2 Zn finger 233..253 CDD:275368 7/19 (37%)
zf-H2C2_2 245..270 CDD:404364 9/24 (38%)
C2H2 Zn finger 261..282 CDD:275368 9/26 (35%)
C2H2 Zn finger 318..338 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.