DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nom and Cf2

DIOPT Version :9

Sequence 1:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster


Alignment Length:278 Identity:63/278 - (22%)
Similarity:112/278 - (40%) Gaps:50/278 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 QTDLQSAMIFRRQCILQQKKWVPLLQSDKVGASEEKKVEPNDPSTKKKTTKRRRGR----PRMPL 116
            |..||:....::|...||::     |..:....|:::.|..:.:.:::....::.:    .::.|
  Fly   228 QQQLQAEHHHQQQHQQQQQQ-----QQQQQELLEQQQREMQEQAQQQQVHHHQQDQDLAGDQVAL 287

  Fly   117 EIVDIVVTNESKASAGESVGGDEF---DQPVEISNEPDATDS------DVNLEEIDLPDEDG-LE 171
            ::..:.|.....|:.|..|...:.   ::|:.:|:..|..:|      ..| ..:..|...| |.
  Fly   288 KVPPLTVKLNKNANGGAIVSHPQVIIKEEPLSLSDSGDVVNSVPVYAIQAN-PGVPAPASSGVLV 351

  Fly   172 SDHDLPNVQIHKCDTCGIIKNNKSSLVRHQFEHNGIRPYPCKECPKTFLVASELKAHNLTH---- 232
            ....:|....||              :||:          |.:|||||.....|..|...|    
  Fly   352 GTQTVPADLAHK--------------IRHK----------CPDCPKTFKTPGTLAMHRKIHTGEA 392

  Fly   233 --HTLEPPFACRYCDRRYFSVVGRKKHERVHTNERPFVCDQCGKAFTRTCILKAHMAVHQVVRKY 295
              ...|.|:.|.||.:.:......|:|.|:||.|:||.|..|.|:|:....|..|:..|...:.|
  Fly   393 DATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPY 457

  Fly   296 SCDVCDRSFSLKKHLATH 313
            :|..||:.|:.:..|..|
  Fly   458 TCPYCDKRFTQRSALTVH 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nomNP_001262384.1 zf-AD 5..76 CDD:214871 6/19 (32%)
C2H2 Zn finger 184..204 CDD:275368 2/19 (11%)
C2H2 Zn finger 212..261 CDD:275368 17/54 (31%)
zf-H2C2_2 255..278 CDD:290200 12/22 (55%)
C2H2 Zn finger 269..289 CDD:275368 6/19 (32%)
zf-H2C2_2 282..305 CDD:290200 7/22 (32%)
C2H2 Zn finger 297..313 CDD:275368 5/15 (33%)
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 35/116 (30%)
C2H2 Zn finger 368..388 CDD:275368 8/19 (42%)
C2H2 Zn finger 403..423 CDD:275368 6/19 (32%)
C2H2 Zn finger 431..451 CDD:275368 6/19 (32%)
zf-H2C2_2 443..468 CDD:316026 8/24 (33%)
C2H2 Zn finger 459..480 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.