DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nom and CG31441

DIOPT Version :9

Sequence 1:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster


Alignment Length:352 Identity:94/352 - (26%)
Similarity:156/352 - (44%) Gaps:46/352 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LINVCRVCGR--SRLCPKAVELFKPGRQDILRRIQLITGILLQQIPNAPDMVCFCCQTDLQSAMI 64
            |.::||.||:  :.|..:|.:||.......:..::.||.:.|:.....|.::|.||:..|...:.
  Fly     4 LRSICRTCGKNVTNLQGRATKLFNKSNYHFISILENITDMYLEFDTTLPHLICQCCKVQLDRILT 68

  Fly    65 FRRQCILQQKKWVPLLQSDKVGASEEKKVEPNDPSTKKKTTKRRRGRP---RMPLEIVDIVVTNE 126
            ||.:|:...|.::         |:..|.:.      ||........:|   ::..::.|  .|::
  Fly    69 FRNKCLEVHKSFM---------AANRKLLR------KKAIVDEELDKPDVEKLQQDLWD--HTDQ 116

  Fly   127 SKASAGESVGG---DEFDQPVEISNEPDATDSDVNLEE-IDLPDEDGLESDHDLPNVQIHK---- 183
            ....|.....|   ::.:...:..:..|||.::.|.|| :.:..|:.......|.|:.|..    
  Fly   117 EMCVAMADTAGLLREDHNDNEKAKDAEDATQNEKNQEEQVQVQTEEVEHCQEQLHNMSIISKGVS 181

  Fly   184 ---------------CDTCGIIKNNKSSLVRHQFEHNGIRPYPCKECPKTFLVASELKAHNLTHH 233
                           ||.||.:..:.:.|..|...|:|.:|:.|..|...:...:|::.|.:. |
  Fly   182 ARVPKRTKRNSKSWFCDQCGGVFKSSTYLKLHLQRHSGHKPFACDICQAKYYTDNEMRRHRIL-H 245

  Fly   234 TLEPPFACRYCDRRYFSVVGRKKHERVHTNERPFVCDQCGKAFTRTCILKAHMAVHQVVRKYSCD 298
            |...|:|||:|.:.|.....:..|||.|||||||.|..|.||||.|...:.|..:|...|||.|:
  Fly   246 TDARPYACRFCSKTYRGCSSKVVHERTHTNERPFQCQHCDKAFTSTSTRQKHEMLHTNQRKYHCE 310

  Fly   299 VCDRSFSLKKHLATHFISNTHKRNAEA 325
            :||:.|....||..|..:..|:|.||:
  Fly   311 ICDQWFLRSSHLTLHQSTKLHQRRAES 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nomNP_001262384.1 zf-AD 5..76 CDD:214871 20/72 (28%)
C2H2 Zn finger 184..204 CDD:275368 6/19 (32%)
C2H2 Zn finger 212..261 CDD:275368 15/48 (31%)
zf-H2C2_2 255..278 CDD:290200 15/22 (68%)
C2H2 Zn finger 269..289 CDD:275368 8/19 (42%)
zf-H2C2_2 282..305 CDD:290200 8/22 (36%)
C2H2 Zn finger 297..313 CDD:275368 6/15 (40%)
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 20/83 (24%)
COG5048 <174..337 CDD:227381 54/163 (33%)
C2H2 Zn finger 197..217 CDD:275370 6/19 (32%)
C2H2 Zn finger 225..245 CDD:275368 4/20 (20%)
C2H2 Zn finger 253..273 CDD:275368 7/19 (37%)
zf-H2C2_2 268..290 CDD:290200 15/21 (71%)
C2H2 Zn finger 281..301 CDD:275368 8/19 (42%)
C2H2 Zn finger 309..328 CDD:275368 7/18 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.