DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nom and CG9215

DIOPT Version :9

Sequence 1:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_573045.1 Gene:CG9215 / 32494 FlyBaseID:FBgn0030659 Length:560 Species:Drosophila melanogaster


Alignment Length:455 Identity:103/455 - (22%)
Similarity:163/455 - (35%) Gaps:148/455 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRVCGRSRLCPKAVELFKPGRQD----ILRRIQLITGILLQQIPNA----PDMVCFCCQTDLQSA 62
            |.||....  |:|..::....:.    ||.:|:..|.:.|...|:.    ||.:|..|..:|..:
  Fly    16 CLVCLAEE--PEASSIYGHDPESPHMLILDKIRCCTSLQLDSSPSQLQRWPDKICKQCHLELSVS 78

  Fly    63 MIFRRQCILQQKKW---------------------VPLL-------------------------- 80
            ..|..:|...||.:                     .|:|                          
  Fly    79 YRFHEKCTAVQKLFRSASRSTSTSAVFAAAAAAPPAPMLVDKQQEQLKLDLEQAHVRLPATLKIR 143

  Fly    81 -------QSDKVGASEEKKVEPNDPSTKKKTTKRRRGRPRMPLEIVD----IVVTNESKASAGES 134
                   .|..|..:.....||::...::||..         |.::.    ::..|:.:|....:
  Fly   144 RLNVEPCSSSSVSGTITTSTEPSEDVKEEKTDS---------LSLIPDGAMVLSLNDFQAQDSIT 199

  Fly   135 VGGDEFD-----------------QPVEISNEPDATDSDVNLEEIDLP-DEDGLESDHDL----- 176
            ...:|.|                 .|.:..|.|:      :|.||:.| .|:.:.:...|     
  Fly   200 QQAEEKDPKKQQDEDEGQAKMLELDPWDDENTPE------HLYEIETPLIEESVVASPPLPLPPT 258

  Fly   177 ---------------PNVQIHK--------------------------CDTCGIIKNNKSSLVRH 200
                           |||:..|                          ||.||.....:.:|..|
  Fly   259 HPANQQKKRTYRRVSPNVKHEKLTANVDDDFKAGSTTKRRNCERSPKICDVCGNTYKYQHALNAH 323

  Fly   201 QFEHNGIRPYPCKECPKTFLVASELKAHNLTHHTLEPPFACRYCDRRYFSVVGRKKHERVHTNER 265
            ...||..|||.|:.|.|.|:...||:.| :..||.:.|::||:|:||:......|||||:||.||
  Fly   324 MRRHNNERPYSCEVCQKAFISNVELRRH-MRVHTGQKPYSCRHCERRFSDFGSSKKHERIHTGER 387

  Fly   266 PFVCDQCGKAFTRTCILKAHMAVHQVVRKYSCDVCDRSFSLKKHLATHFISNTHKRNAEAVTSSS 330
            |:||:.|.|.|....:|.||...|...:::.|..||:.|:.|.:|:.|...:....|.||..:||
  Fly   388 PYVCEVCNKGFAYAHVLSAHRRTHTGKKQFQCTQCDKGFTKKTYLSAHMEQHRGSGNGEASVASS 452

  Fly   331  330
              Fly   453  452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nomNP_001262384.1 zf-AD 5..76 CDD:214871 20/77 (26%)
C2H2 Zn finger 184..204 CDD:275368 6/19 (32%)
C2H2 Zn finger 212..261 CDD:275368 20/48 (42%)
zf-H2C2_2 255..278 CDD:290200 15/22 (68%)
C2H2 Zn finger 269..289 CDD:275368 7/19 (37%)
zf-H2C2_2 282..305 CDD:290200 7/22 (32%)
C2H2 Zn finger 297..313 CDD:275368 6/15 (40%)
CG9215NP_573045.1 zf-AD 16..92 CDD:285071 20/77 (26%)
DUF2117 165..>273 CDD:303038 17/122 (14%)
COG5048 <303..439 CDD:227381 52/136 (38%)
C2H2 Zn finger 307..327 CDD:275368 6/19 (32%)
zf-H2C2_2 319..344 CDD:290200 11/24 (46%)
zf-C2H2 333..355 CDD:278523 8/22 (36%)
C2H2 Zn finger 335..355 CDD:275368 7/20 (35%)
zf-H2C2_2 347..371 CDD:290200 11/24 (46%)
C2H2 Zn finger 363..383 CDD:275368 10/19 (53%)
zf-H2C2_2 375..400 CDD:290200 15/24 (63%)
C2H2 Zn finger 391..411 CDD:275368 7/19 (37%)
zf-H2C2_2 404..427 CDD:290200 7/22 (32%)
C2H2 Zn finger 419..439 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4797
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.