DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nom and ZNF281

DIOPT Version :9

Sequence 1:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001268222.1 Gene:ZNF281 / 23528 HGNCID:13075 Length:895 Species:Homo sapiens


Alignment Length:391 Identity:88/391 - (22%)
Similarity:138/391 - (35%) Gaps:105/391 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PNAPDMVCFCCQTDLQSAMIFRRQCILQQKKWVPLLQSDKVGASEEKKVEPNDPSTKKKTTKRRR 109
            |.||||.  ..:....||..|..    |:..| ..||| .|...:||..:|.:..:.........
Human    93 PPAPDMT--FKKEPAASAAAFPS----QRTSW-GFLQS-LVSIKQEKPADPEEQQSHHHHHHHHY 149

  Fly   110 G------RPRMP---------------LEIV-------------DIVVTNESKASAGESVGGDEF 140
            |      ..|.|               |.|:             |:::::.|:..  :..|.:|.
Human   150 GGLFAGAEERSPGLGGGEGGSHGVIQDLSILHQHVQQQPAQHHRDVLLSSSSRTD--DHHGTEEP 212

  Fly   141 DQPVEISNEPDATDSDVNLEEIDLPDEDGLESDHD------------------LPNVQIHKCDTC 187
            .|           |::|...:...|:..|:::...                  .|:.:.|.||.|
Human   213 KQ-----------DTNVKKAKRPKPESQGIKAKRKPSASSKPSLVGDGEGAILSPSQKPHICDHC 266

  Fly   188 GIIKNNKSSLVRHQFEHNGIRPYPCKECPKTFLVASELKAHNLTHHTLEPPFACRYCDRRYFSVV 252
            .....:...|.||...|.|.||:.|.:|...|:....|:.|... |:.|.||.|..|..::....
Human   267 SAAFRSSYHLRRHVLIHTGERPFQCSQCSMGFIQKYLLQRHEKI-HSREKPFGCDQCSMKFIQKY 330

  Fly   253 GRKKHERVHTNERPFVCDQCGKAFTRT-CILKAHMAVHQVVRKYSCDV----------------- 299
            ..::|:|.|:.|:|:.||.|.:.|:|| .:||......:|:.|.:...                 
Human   331 HMERHKRTHSGEKPYKCDTCQQYFSRTDRLLKHRRTCGEVIVKGATSAEPGSSNHTNMGNLAVLS 395

  Fly   300 -----CDRSFSLKKHLATHFISN----THKRNAEAVTSSSEYMSMLSFESDETWSQGTPLTTSID 355
                 ..|..:..|.:|   |.|    |.|.| |:..|::..|...|.|.....|.|..:.|.||
Human   396 QGNTSSSRRKTKSKSIA---IENKEQKTGKTN-ESQISNNINMQSYSVEMPTVSSSGGIIGTGID 456

  Fly   356 E 356
            |
Human   457 E 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nomNP_001262384.1 zf-AD 5..76 CDD:214871 9/30 (30%)
C2H2 Zn finger 184..204 CDD:275368 6/19 (32%)
C2H2 Zn finger 212..261 CDD:275368 13/48 (27%)
zf-H2C2_2 255..278 CDD:290200 9/22 (41%)
C2H2 Zn finger 269..289 CDD:275368 8/20 (40%)
zf-H2C2_2 282..305 CDD:290200 5/44 (11%)
C2H2 Zn finger 297..313 CDD:275368 3/37 (8%)
ZNF281NP_001268222.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..113 8/21 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 130..149 3/18 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 183..253 9/82 (11%)
C2H2 Zn finger 263..283 CDD:275368 6/19 (32%)
zf-H2C2_2 275..300 CDD:316026 10/24 (42%)
C2H2 Zn finger 291..311 CDD:275368 5/20 (25%)
zf-H2C2_2 304..328 CDD:316026 8/24 (33%)
C2H2 Zn finger 319..339 CDD:275368 4/19 (21%)
zf-H2C2_2 331..356 CDD:316026 9/24 (38%)
C2H2 Zn finger 347..366 CDD:275368 8/18 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 377..427 9/53 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 638..660
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 778..817
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.