DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment nom and Zfp341

DIOPT Version :9

Sequence 1:	NP_001262384.1	Gene:	nom / 41038	FlyBaseID:	FBgn0037617	Length:	370	Species:	Drosophila melanogaster
Sequence 2:	NP_955008.2	Gene:	Zfp341 / 228807	MGIID:	2682937	Length:	846	Species:	Mus musculus

Alignment Length:	149	Identity:	43/149 - (28%)
Similarity:	66/149 - (44%)	Gaps:	12/149 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   181 IHKCDTCGIIKNNKSSLVRHQFEHNGIRPYPCKECPKTFLVASELKAHNLTHHTLEPPFACRYCD 245
            ::||..| :.|.:....:.|..: .....:||..|.|.|.....|:.|..||.: ...|.|:.|.
Mouse   536 VYKCVKC-VNKYSTPEALEHHVQ-TATHSFPCPHCQKVFPCERYLRRHLPTHGS-GGRFRCQICK 597

  Fly   246 RRYFSVVGRKKHERVHTNERPFVCDQCGKAFTRTCILKAHMAVHQVVRKYSCDV-----CDRSFS 305
            :.:......|.|..:|:.|:|:.|..|..||.|...||.||.:|:..:||.|..     |.:.|:
Mouse   598 KFFRKEHYLKLHAHIHSGEKPYKCSVCESAFNRKDKLKRHMLIHEPFKKYKCPFSMHTGCSKEFN 662

  Fly   306 ----LKKHLATHFISNTHK 320
                ||.|:.:|.....||
Mouse   663 RQDKLKAHILSHAGLKLHK 681

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
nom	NP_001262384.1	zf-AD	5..76	CDD:214871
		C2H2 Zn finger	184..204	CDD:275368	4/19 (21%)
		C2H2 Zn finger	212..261	CDD:275368	13/48 (27%)
		zf-H2C2_2	255..278	CDD:290200	9/22 (41%)
		C2H2 Zn finger	269..289	CDD:275368	9/19 (47%)
		zf-H2C2_2	282..305	CDD:290200	9/27 (33%)
		C2H2 Zn finger	297..313	CDD:275368	6/24 (25%)
Zfp341	NP_955008.2	COG5048	321..726	CDD:227381	43/149 (29%)
		zf-C2H2	321..342	CDD:278523
		C2H2 Zn finger	322..342	CDD:275368
		zf-H2C2_2	334..359	CDD:290200
		C2H2 Zn finger	350..370	CDD:275368
		C2H2 Zn finger	444..464	CDD:275368
		C2H2 Zn finger	472..494	CDD:275368
		C2H2 Zn finger	502..522	CDD:275368
		C2H2 Zn finger	539..561	CDD:275370	4/23 (17%)
		C2H2 Zn finger	565..585	CDD:275368	6/19 (32%)
		C2H2 Zn finger	593..613	CDD:275368	4/19 (21%)
		zf-H2C2_2	605..630	CDD:290200	9/24 (38%)
		C2H2 Zn finger	621..641	CDD:275368	9/19 (47%)
		C2H2 Zn finger	649..674	CDD:275368	6/24 (25%)
		C2H2 Zn finger	682..702	CDD:275368	43/149 (29%)
		C2H2 Zn finger	710..727	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167836414
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930