DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nom and M03D4.4

DIOPT Version :9

Sequence 1:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001023313.1 Gene:M03D4.4 / 177375 WormBaseID:WBGene00019751 Length:505 Species:Caenorhabditis elegans


Alignment Length:245 Identity:68/245 - (27%)
Similarity:101/245 - (41%) Gaps:41/245 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 GDEFDQPVEISNEPDATDSD-VNLEEIDLPDEDGLESDHDLPNVQI----------------HKC 184
            ||:.:..:|       .||| :.:.:|.:.|.|.| ||.|...:.:                ::|
 Worm    34 GDQEEDRME-------DDSDELAMIKIKIEDSDFL-SDTDSSQLSMNPTTPSEKSSSGEKGRYEC 90

  Fly   185 DTCGIIKNNKSSLVRHQFEHNGIRPYPCKECPKTFLVASELKAHNLTHHTLEPPFACRYCDRRYF 249
            :.|..:...|..|..|...|:|.:|:.|.:|.|.|.....||.|.: .||.|....|.:|::.:|
 Worm    91 EDCHEMFAVKRELATHMRIHSGEQPHSCTQCGKEFGTRQLLKKHWM-WHTGERSHVCPHCNKAFF 154

  Fly   250 SVVGRKKHERVHTNERPFVCDQCGKAFTRTCILKAHMAVHQVVRKYSCDVCDRSFSLKKHLATHF 314
            ......:|..:|:..||..|.||.|.|.....|..||.:|| .|.:||..|.|||..:..|..|.
 Worm   155 QKGHLTQHLMIHSGGRPHECPQCHKTFIFKFDLNRHMKIHQ-ERGFSCQQCGRSFLKQVMLDEHH 218

  Fly   315 ISNTHKRNAEAVTSSSEYMSMLSFESDETWSQGTPLTTSI---DEDLVQS 361
            :....|       .||...|:|:    .|...|.....||   .|.::.|
 Worm   219 LKCKGK-------PSSPIRSLLT----PTMKAGLESAISIKPPQESMILS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nomNP_001262384.1 zf-AD 5..76 CDD:214871
C2H2 Zn finger 184..204 CDD:275368 5/19 (26%)
C2H2 Zn finger 212..261 CDD:275368 14/48 (29%)
zf-H2C2_2 255..278 CDD:290200 9/22 (41%)
C2H2 Zn finger 269..289 CDD:275368 8/19 (42%)
zf-H2C2_2 282..305 CDD:290200 11/22 (50%)
C2H2 Zn finger 297..313 CDD:275368 6/15 (40%)
M03D4.4NP_001023313.1 C2H2 Zn finger 90..110 CDD:275368 5/19 (26%)
zf-H2C2_2 102..127 CDD:290200 9/24 (38%)
C2H2 Zn finger 118..138 CDD:275368 7/20 (35%)
C2H2 Zn finger 146..166 CDD:275368 4/19 (21%)
zf-H2C2_2 158..181 CDD:290200 8/22 (36%)
zf-C2H2 172..194 CDD:278523 8/21 (38%)
C2H2 Zn finger 174..194 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.