DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nom and blmp-1

DIOPT Version :9

Sequence 1:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001251370.1 Gene:blmp-1 / 172917 WormBaseID:WBGene00003847 Length:817 Species:Caenorhabditis elegans


Alignment Length:410 Identity:107/410 - (26%)
Similarity:156/410 - (38%) Gaps:105/410 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 QQIPNAPDMVCFCCQTDLQSAMIFRRQCILQQKKWV--PL--LQSDKVGASEEKKVE-------- 94
            |.||:||..........|...::.....:   ||.:  |:  |.:|...||:|:.::        
 Worm   264 QLIPSAPPASASTAIASLAETIVAIDYSV---KKLIESPIDTLSTDASSASDEEMIDVEEQESCT 325

  Fly    95 --------PN---DPSTKKKTTK--------RRRG--------------RPRMPLEIVD--IVVT 124
                    ||   :|..:...||        .|.|              |..:.|::||  :.|:
 Worm   326 RPVAEVTRPNVIQNPVVRPVATKVNNFPGIPVRLGNFYASPLVDFKEFMRKSLQLKLVDTSMFVS 390

  Fly   125 NESKASAGESVGGDEFDQPVEISNEPDAT------------DSDVNLEEIDLP----------DE 167
            ..::.:|..:..|....||:::.....||            .|.....|:..|          ..
 Worm   391 PVAQTTAAITATGGRSGQPIDVQPVLAATAGAHFGNYAAIYGSQDFQHELSKPLYTSASPAFGGG 455

  Fly   168 DGL------------ESDHDLPNVQIHKCDTCGIIKNNKSSL------VRHQFEHNGIRPYPCKE 214
            .|:            .|.|.||.|. |...:     :|.||.      |:.|  .||...|.||:
 Worm   456 GGMGGGFGMGGSAHTSSFHQLPFVN-HSSSS-----HNDSSFNGVPNYVQQQ--ENGKTRYACKD 512

  Fly   215 CPKTFLVASELKAHNLTHHTLEPPFACRYCDRRYFSVVGRKKHERVHTNERPFVCDQCGKAFTRT 279
            |.|||...|.||.|..| ||.|.||.|..|.:.:..:...:||..|||.|||..||.|.|.|:.|
 Worm   513 CNKTFGQLSNLKVHVRT-HTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSST 576

  Fly   280 CILKAHMAVHQVVRKYSCDVCDRSFSLKKHLATHFISNTHKRNAEAVTSSSEYMSMLSFESDETW 344
            ..||.|:.:|...:.|:|||||..|:...||..|...:.::|.....|...:|:|.....:.  |
 Worm   577 SNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISPSGLRTH--W 639

  Fly   345 SQGTPLTTSIDEDLVQSQFD 364
            .    .||..:||:..|..|
 Worm   640 K----TTTCKEEDMKDSMRD 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nomNP_001262384.1 zf-AD 5..76 CDD:214871 7/33 (21%)
C2H2 Zn finger 184..204 CDD:275368 5/25 (20%)
C2H2 Zn finger 212..261 CDD:275368 20/48 (42%)
zf-H2C2_2 255..278 CDD:290200 13/22 (59%)
C2H2 Zn finger 269..289 CDD:275368 9/19 (47%)
zf-H2C2_2 282..305 CDD:290200 10/22 (45%)
C2H2 Zn finger 297..313 CDD:275368 8/15 (53%)
blmp-1NP_001251370.1 SET 119..247 CDD:214614
zf-C2H2 508..530 CDD:278523 12/22 (55%)
C2H2 Zn finger 510..530 CDD:275368 11/20 (55%)
zf-H2C2_2 522..547 CDD:290200 11/25 (44%)
C2H2 Zn finger 538..558 CDD:275368 4/19 (21%)
zf-H2C2_2 550..575 CDD:290200 13/24 (54%)
C2H2 Zn finger 566..586 CDD:275368 9/19 (47%)
zf-H2C2_2 578..603 CDD:290200 11/24 (46%)
C2H2 Zn finger 594..614 CDD:275368 9/19 (47%)
zf-H2C2_2 606..631 CDD:290200 6/24 (25%)
ARS2 <620..772 CDD:282772 10/42 (24%)
C2H2 Zn finger 622..641 CDD:275368 4/24 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.