DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nom and ZNF784

DIOPT Version :9

Sequence 1:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_976308.1 Gene:ZNF784 / 147808 HGNCID:33111 Length:323 Species:Homo sapiens


Alignment Length:175 Identity:55/175 - (31%)
Similarity:74/175 - (42%) Gaps:44/175 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 KCDTCGIIKNNKSSLVRHQFEHNGIRPYPCKECPKTFLVASELKAHNLTHHTLEP---------- 237
            :|..||......:||..|...|.|.|||.|..||:.|...:.|..|. ..|.:||          
Human   102 RCHVCGHSCPGPASLRAHYSLHTGERPYRCALCPRAFKALAPLLRHQ-HRHGVEPGTSRRPPDTA 165

  Fly   238 -----------------------------PFACRYCDRRYFSVVGRKKHERVHTNERPFVCDQCG 273
                                         |||||:|.:.:......:.||||||.|||:.|..||
Human   166 AVAEQRPGVAPERAEVVMAAAAAGAAVGKPFACRFCAKPFRRSSDMRDHERVHTGERPYHCGICG 230

  Fly   274 KAFTRTCILKAHMAVHQVVRKYSCDVCDRSF----SLKKHLATHF 314
            |.||::.:|..|..:|...|.:.|.:|||:|    :.:||..|||
Human   231 KGFTQSSVLSGHARIHTGERPFRCTLCDRTFNNSSNFRKHQRTHF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nomNP_001262384.1 zf-AD 5..76 CDD:214871
C2H2 Zn finger 184..204 CDD:275368 6/19 (32%)
C2H2 Zn finger 212..261 CDD:275368 18/87 (21%)
zf-H2C2_2 255..278 CDD:290200 14/22 (64%)
C2H2 Zn finger 269..289 CDD:275368 8/19 (42%)
zf-H2C2_2 282..305 CDD:290200 9/26 (35%)
C2H2 Zn finger 297..313 CDD:275368 7/19 (37%)
ZNF784NP_976308.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
C2H2 Zn finger 67..87 CDD:275368
C2H2 Zn finger 103..123 CDD:275368 6/19 (32%)
C2H2 Zn finger 131..151 CDD:275368 6/20 (30%)
COG5048 <194..276 CDD:227381 35/82 (43%)
C2H2 Zn finger 198..218 CDD:275368 6/19 (32%)
C2H2 Zn finger 226..246 CDD:275368 8/19 (42%)
C2H2 Zn finger 254..274 CDD:275368 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 269..323 5/7 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4797
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.