DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11760 and zgc:112294

DIOPT Version :10

Sequence 1:NP_649819.1 Gene:CG11760 / 41036 FlyBaseID:FBgn0037615 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_073806508.1 Gene:zgc:112294 / 553704 ZFINID:ZDB-GENE-050522-418 Length:222 Species:Danio rerio


Alignment Length:127 Identity:32/127 - (25%)
Similarity:54/127 - (42%) Gaps:30/127 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EVLIYLNSFYFGMFACCEMAMGLLKAINLSY--TGHTLALDTGVMISFIVFETIRLIMGRMSSLA 83
            ::::|.|.|:|..:...|:.|..||   .||  ..:...|.|| |:...:||.:|:.:|...:|.
Zfish    55 QMMLYFNMFFFPFWWISELLMLQLK---FSYLPVYYQCLLVTG-MVLISIFEVLRMYLGYAGNLK 115

  Fly    84 DR------GW-------SAILSVFMTAPCFVGVSYLLLLQTYRLRLEYCLCTLQIALYLTEV 132
            ::      .|       ..||..|:|.|..:           .|.||..:.:|.:|..|.|:
Zfish   116 EKVPELAGFWLISFLFQLPILLFFITDPDII-----------ILPLERAVHSLYLAFLLGEL 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11760NP_649819.1 Transmemb_17 22..128 CDD:462907 30/120 (25%)
zgc:112294XP_073806508.1 None

Return to query results.
Submit another query.