DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cks85A and CKS1

DIOPT Version :9

Sequence 1:NP_001246992.1 Gene:Cks85A / 41034 FlyBaseID:FBgn0037613 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_009693.3 Gene:CKS1 / 852432 SGDID:S000000339 Length:150 Species:Saccharomyces cerevisiae


Alignment Length:94 Identity:44/94 - (46%)
Similarity:58/94 - (61%) Gaps:12/94 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DQIQYSEKYFDDNFEYRHVILPPDLAKHVPKAH---------LMTETEWRNLGVQQSPGWVHYMV 59
            |.|.||.:|.|||:|||||:||..:.|.:|..:         ::||.|||.||:.||.||.||..
Yeast    26 DSIHYSPRYSDDNYEYRHVMLPKAMLKVIPSDYFNSEVGTLRILTEDEWRGLGITQSLGWEHYEC 90

  Fly    60 HAPEPHVILFRRKRIPAEDAPQVAAANAA 88
            ||||||::||:|   |.....::.||.||
Yeast    91 HAPEPHILLFKR---PLNYEAELRAATAA 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cks85ANP_001246992.1 CKS 8..73 CDD:279455 37/73 (51%)
CKS1NP_009693.3 CKS 30..104 CDD:395882 37/76 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346560
Domainoid 1 1.000 90 1.000 Domainoid score I1771
eggNOG 1 0.900 - - E1_KOG3484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I1535
Isobase 1 0.950 - 0 Normalized mean entropy S367
OMA 1 1.010 - - QHG53792
OrthoFinder 1 1.000 - - FOG0001114
OrthoInspector 1 1.000 - - otm46818
orthoMCL 1 0.900 - - OOG6_100899
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X683
TreeFam 1 0.960 - -
1211.610

Return to query results.
Submit another query.