DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cks85A and CKS1

DIOPT Version :9

Sequence 1:NP_001246992.1 Gene:Cks85A / 41034 FlyBaseID:FBgn0037613 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_180363.1 Gene:CKS1 / 817340 AraportID:AT2G27960 Length:87 Species:Arabidopsis thaliana


Alignment Length:67 Identity:49/67 - (73%)
Similarity:58/67 - (86%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QIQYSEKYFDDNFEYRHVILPPDLAKHVPKAHLMTETEWRNLGVQQSPGWVHYMVHAPEPHVILF 69
            |||||||||||.||||||:|||::||.:||..|::|.|||.:|||||.|||||.||.||||::||
plant     3 QIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAVHRPEPHIMLF 67

  Fly    70 RR 71
            ||
plant    68 RR 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cks85ANP_001246992.1 CKS 8..73 CDD:279455 46/64 (72%)
CKS1NP_180363.1 PLN00010 1..71 CDD:215027 49/67 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 117 1.000 Domainoid score I1954
eggNOG 1 0.900 - - E1_KOG3484
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I2007
OMA 1 1.010 - - QHG53792
OrthoDB 1 1.010 - - D1377855at2759
OrthoFinder 1 1.000 - - FOG0001114
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100899
Panther 1 1.100 - - O PTHR23415
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X683
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.