DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cks85A and Cks1l

DIOPT Version :9

Sequence 1:NP_001246992.1 Gene:Cks85A / 41034 FlyBaseID:FBgn0037613 Length:96 Species:Drosophila melanogaster
Sequence 2:XP_038967489.1 Gene:Cks1l / 681162 RGDID:1583529 Length:79 Species:Rattus norvegicus


Alignment Length:71 Identity:51/71 - (71%)
Similarity:59/71 - (83%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPADQIQYSEKYFDDNFEYRHVILPPDLAKHVPKAHLMTETEWRNLGVQQSPGWVHYMVHAPEPH 65
            |...||.||:||.|:.||||||:||.|:||.|||.|||.|:||||||||||.||||||:|.||||
  Rat     1 MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMFESEWRNLGVQQSQGWVHYMIHEPEPH 65

  Fly    66 VILFRR 71
            ::||||
  Rat    66 ILLFRR 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cks85ANP_001246992.1 CKS 8..73 CDD:279455 48/64 (75%)
Cks1lXP_038967489.1 CKS 8..73 CDD:395882 48/64 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353892
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53792
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001114
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100899
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X683
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.