DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cks85A and Cks1brt

DIOPT Version :9

Sequence 1:NP_001246992.1 Gene:Cks85A / 41034 FlyBaseID:FBgn0037613 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_001033011.1 Gene:Cks1brt / 624855 MGIID:3643620 Length:96 Species:Mus musculus


Alignment Length:70 Identity:46/70 - (65%)
Similarity:56/70 - (80%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPADQIQYSEKYFDDNFEYRHVILPPDLAKHVPKAHLMTETEWRNLGVQQSPGWVHYMVHAPEPH 65
            |...||.||:||.|:.||||||:||.|:.|.|||.|||:|:|||.||||||.||||||:|.||.|
Mouse    18 MSHKQIYYSDKYDDEEFEYRHVMLPKDIDKLVPKTHLMSESEWRKLGVQQSQGWVHYMIHEPELH 82

  Fly    66 VILFR 70
            ::||:
Mouse    83 ILLFQ 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cks85ANP_001246992.1 CKS 8..73 CDD:279455 43/63 (68%)
Cks1brtNP_001033011.1 CKS 25..90 CDD:279455 43/63 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850197
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53792
OrthoDB 1 1.010 - - D1377855at2759
OrthoFinder 1 1.000 - - FOG0001114
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100899
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X683
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.760

Return to query results.
Submit another query.