DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cks85A and cks2

DIOPT Version :9

Sequence 1:NP_001246992.1 Gene:Cks85A / 41034 FlyBaseID:FBgn0037613 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_001038434.1 Gene:cks2 / 561930 ZFINID:ZDB-GENE-050208-508 Length:78 Species:Danio rerio


Alignment Length:73 Identity:47/73 - (64%)
Similarity:59/73 - (80%) Gaps:1/73 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QIQYSEKYFDDNFEYRHVILPPDLAKHVPKAHLMTETEWRNLGVQQSPGWVHYMVHAPEPHVILF 69
            ||.||:||.|:.:|||||:||..|:|.||.:|||:|.|||.||||||.||:|||:|.||||::||
Zfish     7 QIYYSDKYSDEEYEYRHVMLPKQLSKLVPSSHLMSEEEWRGLGVQQSQGWIHYMIHKPEPHILLF 71

  Fly    70 RRKRIPAE 77
            ||. :|.|
Zfish    72 RRP-LPKE 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cks85ANP_001246992.1 CKS 8..73 CDD:279455 43/64 (67%)
cks2NP_001038434.1 CKS 10..75 CDD:279455 43/65 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3484
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53792
OrthoDB 1 1.010 - - D1377855at2759
OrthoFinder 1 1.000 - - FOG0001114
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100899
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X683
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.690

Return to query results.
Submit another query.