DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cks85A and CG7006

DIOPT Version :10

Sequence 1:NP_649817.1 Gene:Cks85A / 41034 FlyBaseID:FBgn0037613 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_651296.1 Gene:CG7006 / 42963 FlyBaseID:FBgn0039233 Length:180 Species:Drosophila melanogaster


Alignment Length:48 Identity:15/48 - (31%)
Similarity:19/48 - (39%) Gaps:13/48 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FDDNFEYRHVILPPDLAKHVPKAHLMTETEWRNLGVQQSPGWVHYMVH 60
            |:..|.|         ..|:||..|...||  |.|  |..|.|.|.::
  Fly   103 FEQQFLY---------GNHIPKTGLGRITE--NAG--QYQGVVVYSMN 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cks85ANP_649817.1 CKS 6..73 CDD:460068 15/48 (31%)
CG7006NP_651296.1 Nip7_N_euk 4..88 CDD:409283
PUA_Nip7-like 95..172 CDD:409293 15/48 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.