DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cks85A and zgc:86839

DIOPT Version :9

Sequence 1:NP_001246992.1 Gene:Cks85A / 41034 FlyBaseID:FBgn0037613 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_001002110.1 Gene:zgc:86839 / 415200 ZFINID:ZDB-GENE-040625-102 Length:75 Species:Danio rerio


Alignment Length:71 Identity:49/71 - (69%)
Similarity:58/71 - (81%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPADQIQYSEKYFDDNFEYRHVILPPDLAKHVPKAHLMTETEWRNLGVQQSPGWVHYMVHAPEPH 65
            |...||.||:||.||:||||||:||.:|||.|||:|||:|.|.|.||||||.||||||:|.||.|
Zfish     1 MSHKQIYYSDKYTDDHFEYRHVVLPRELAKQVPKSHLMSEDECRRLGVQQSLGWVHYMIHEPESH 65

  Fly    66 VILFRR 71
            ::||||
Zfish    66 ILLFRR 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cks85ANP_001246992.1 CKS 8..73 CDD:279455 46/64 (72%)
zgc:86839NP_001002110.1 CKS 8..73 CDD:279455 46/64 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596072
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53792
OrthoDB 1 1.010 - - D1377855at2759
OrthoFinder 1 1.000 - - FOG0001114
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100899
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X683
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.