powered by:
Protein Alignment Cks85A and Sbp2
DIOPT Version :9
Sequence 1: | NP_001246992.1 |
Gene: | Cks85A / 41034 |
FlyBaseID: | FBgn0037613 |
Length: | 96 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_648204.1 |
Gene: | Sbp2 / 38934 |
FlyBaseID: | FBgn0087039 |
Length: | 313 |
Species: | Drosophila melanogaster |
Alignment Length: | 53 |
Identity: | 14/53 - (26%) |
Similarity: | 25/53 - (47%) |
Gaps: | 7/53 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 VILPPDLAKHVPKAHLMTETEWRNLGVQQSPGWVHYMVHAPEPHVILFRRKRI 74
||.|....:...|||.:.:| :|.:.:. .|:|:.|:....|..:|:|
Fly 44 VIKPRPKTQRQTKAHKLQKT---HLAITRG----SYIVYKPKGKTRLDPKKKI 89
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Cks85A | NP_001246992.1 |
CKS |
8..73 |
CDD:279455 |
12/50 (24%) |
Sbp2 | NP_648204.1 |
Ribosomal_L7Ae |
200..290 |
CDD:279573 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm48570 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.