DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cks85A and Sbp2

DIOPT Version :9

Sequence 1:NP_001246992.1 Gene:Cks85A / 41034 FlyBaseID:FBgn0037613 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_648204.1 Gene:Sbp2 / 38934 FlyBaseID:FBgn0087039 Length:313 Species:Drosophila melanogaster


Alignment Length:53 Identity:14/53 - (26%)
Similarity:25/53 - (47%) Gaps:7/53 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VILPPDLAKHVPKAHLMTETEWRNLGVQQSPGWVHYMVHAPEPHVILFRRKRI 74
            ||.|....:...|||.:.:|   :|.:.:.    .|:|:.|:....|..:|:|
  Fly    44 VIKPRPKTQRQTKAHKLQKT---HLAITRG----SYIVYKPKGKTRLDPKKKI 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cks85ANP_001246992.1 CKS 8..73 CDD:279455 12/50 (24%)
Sbp2NP_648204.1 Ribosomal_L7Ae 200..290 CDD:279573
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48570
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.